Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504170

WD Repeat Domain, phosphoinositide Interacting 1 (WIPI1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930533H01Rik, AW411817, D11Ertd498e, ATG18, ATG18A, WIPI49, RGD1307754, atg18, wipi49, zgc:64205, WIPI1, MGC145296
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504170
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WIPI1 antibody: synthetic peptide directed towards the middle region of human WIPI1
Sequence LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPG YSEDGGALRG
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Bovine : 92%, Guinea pig : 92%, Pig : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against WIPI1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WIPI1
Background WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su
Molecular Weight 49kDa
Gene ID 55062
NCBI Accession NP_060453, NM_017983
UniProt Q5MNZ9
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WIPI1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Proikas-Cezanne, Ruckerbauer, Stierhof et al.: "Human WIPI-1 puncta-formation: a novel assay to assess mammalian autophagy." in: FEBS letters, Vol. 581, Issue 18, pp. 3396-404, 2007 (PubMed).

Alternatives for antigen "WD Repeat Domain, phosphoinositide Interacting 1 (WIPI1)", type "Antibodies"
Hosts (28), (4)
Reactivities (30), (18), (17), (12)
Applications (23), (13), (10), (5), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (2), (2), (2), (2), (1), (1)
Beacon