Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504378

One Cut Homeobox 2 (ONECUT2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OC-2, OC2, C730009D12, Oc2, RGD1564677
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504378
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ONECUT2 antibody: synthetic peptide directed towards the middle region of human ONECUT2
Sequence LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFT DLQRRTLFAI
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against ONECUT2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ONECUT2
Background ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT
Molecular Weight 54kDa
Gene ID 9480
NCBI Accession NP_004843, NM_014216
UniProt O95948
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ONECUT2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Chamberlain, Qian, Stiles et al.: "Integration of inositol phosphate signaling pathways via human ITPK1." in: The Journal of biological chemistry, Vol. 282, Issue 38, pp. 28117-25, 2007 (PubMed).

Alternatives for antigen "One Cut Homeobox 2 (ONECUT2)", type "Antibodies"
Hosts (8), (1)
Reactivities (8), (3), (1), (1), (1)
Applications (8), (2), (2), (1), (1), (1)
Epitopes (5), (2), (2), (1), (1)
Beacon