Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504508

Esterase D (ESD) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Es10, Es-10, sid478, wu:fb58f05, zgc:111984, FGH, ARABIDOPSIS THALIANA S-FORMYLGLUTATHIONE HYDROLASE, ATSFGH, S-formylglutathione hydrolase, T32G6.5, T32G6_5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504508
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ESD antibody: synthetic peptide directed towards the N terminal of human ESD
Sequence MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKA ETGKCPALYW
Predicted Reactivity Dog : 100%, Pig : 100%, Zebrafish : 90%, African clawed frog : 84%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against ESD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ESD
Background ESD is a serine hydrolase involved in the detoxification of formaldehyde.
Molecular Weight 31kDa
Gene ID 2098
NCBI Accession NP_001975, NM_001984
UniProt P10768
Research Area Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ESD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).

Alternatives for antigen "Esterase D (ESD)", type "Antibodies"
Hosts (10), (4)
Reactivities (11), (2), (2), (1), (1)
Applications (14), (6), (3), (1), (1)
Epitopes (3), (2), (1), (1)
Beacon