Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504534

Keratin 75 (KRT75) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PFB, K6HF, KB18, K6hf, Krtcap1, AA589387, Krt2-6hf, 4732468K03Rik, Kb18, KRT75
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504534
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KRT75 antibody: synthetic peptide directed towards the N terminal of human KRT75
Sequence MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARS AAGSGGLGRI
Predicted Reactivity Rabbit : 78%
Characteristics This is a rabbit polyclonal antibody against KRT75. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KRT75
Background This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion
Molecular Weight 59kDa
Gene ID 9119
NCBI Accession NP_004684, NM_004693
UniProt O95678
Research Area Signaling, Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KRT75 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Schweizer, Bowden, Coulombe et al.: "New consensus nomenclature for mammalian keratins." in: The Journal of cell biology, Vol. 174, Issue 2, pp. 169-74, 2006 (PubMed).

Alternatives for antigen "Keratin 75 (KRT75)", type "Antibodies"
Hosts (17), (9), (4)
Reactivities (24), (4), (3), (2), (2), (2), (1)
Applications (23), (12), (6), (6), (5), (4), (2), (1), (1), (1)
Epitopes (5), (3), (2), (2), (1), (1)
Beacon