Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504536

Glia Maturation Factor, gamma (GMFG) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GMF-GAMMA, AI324845, 0610039G16Rik, 2310057N07Rik, gmf-gamma, ENSMUSG00000049365, MGC108238, zgc:136987
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN504536
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GMFG antibody: synthetic peptide directed towards the middle region of human GMFG
Sequence KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYK YVHDDGRVSY
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Mouse : 85%, Rat : 85%, African clawed frog : 76%
Characteristics This is a rabbit polyclonal antibody against GMFG. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GMFG
Background The specific function of this protein remains unknown.
Molecular Weight 17kDa
Gene ID 9535
NCBI Accession NP_004868, NM_004877
UniProt O60234
Research Area Signaling, Cytoskeleton, Microfilaments
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GMFG antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Aljehani, Bamzahim, Yousif et al.: "In vivo reliability of an infrared fluorescence method for quantification of carious lesions in orthodontic patients." in: Oral health & preventive dentistry, Vol. 4, Issue 2, pp. 145-50, 2006 (PubMed).

Background publications Shi, Chen, Liotta et al.: "Glia maturation factor gamma (GMFG): a cytokine-responsive protein during hematopoietic lineage development and its functional genomics analysis." in: Genomics, proteomics & bioinformatics, Vol. 4, Issue 3, pp. 145-55, 2006 (PubMed).

Alternatives for antigen "Glia Maturation Factor, gamma (GMFG)", type "Antibodies"
Hosts (24), (2)
Reactivities (25), (14), (14)
Applications (15), (10), (8), (6), (6), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (1), (1)
Beacon