Glia Maturation Factor, gamma (GMFG) (Middle Region) antibody

Details for Product No. ABIN504536
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC108238, zgc:136987, GMF-GAMMA, 0610039G16Rik, 2310057N07Rik, AI324845, gmf-gamma, ENSMUSG00000049365
Epitope
Middle Region
(4), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
(25), (15), (14)
Host
Rabbit
(24), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (10), (8), (6), (4), (2), (2)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504536
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GMFG
Sequence KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYK YVHDDGRVSY
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Mouse : 80 %, Rat : 80 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against GMFG. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GMFG
Background The specific function of this protein remains unknown.
Molecular Weight 17 kDa
Gene ID 9535
NCBI Accession NM_004877, NP_004868
UniProt O60234
Research Area Signaling, Cytoskeleton, Microfilaments
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 142 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glia Maturation Factor, gamma (GMFG) (Middle Region) antibody WB Suggested Anti-GMFG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus
Product cited in: Aljehani, Bamzahim, Yousif et al.: "In vivo reliability of an infrared fluorescence method for quantification of carious lesions in orthodontic patients." in: Oral health & preventive dentistry, Vol. 4, Issue 2, pp. 145-50, 2006 (PubMed).

Background publications Shi, Chen, Liotta et al.: "Glia maturation factor gamma (GMFG): a cytokine-responsive protein during hematopoietic lineage development and its functional genomics analysis." in: Genomics, proteomics & bioinformatics, Vol. 4, Issue 3, pp. 145-55, 2006 (PubMed).

Validation Images
back to top