Did you know that you can buy products from over 140 different suppliers from us?

Programmed Cell Death 7 (PDCD7) (Middle Region) antibody

Details for Product No. ABIN504538
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ES18, HES18, C80112
Epitope
Middle Region
(7), (7), (6), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(32), (17), (14), (12), (11), (11)
Host
Rabbit
(25), (12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(28), (17), (9), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504538
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PDCD7
Sequence YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLP PLPSNDIWAT
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Guinea pig : 90 %, Dog : 80 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PDCD7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PDCD7
Background PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramid
Molecular Weight 55 kDa
Gene ID 10081
NCBI Accession NM_005707, NP_005698
UniProt Q8N8D1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 485 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Programmed Cell Death 7 (PDCD7) (Middle Region) antibody WB Suggested Anti-PDCD7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: NCI-H226 cell lysate
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504538
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top