Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504546

T-Cell Leukemia/lymphoma 1A (TCL1A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TCL1, Tcl1, Tcl1a, TCL1A
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504546
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TCL1A antibody: synthetic peptide directed towards the N terminal of human TCL1A
Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIE IKDRLQLRVL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against TCL1A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TCL1A
Background TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3,promote nuclear translocation of AKT1,enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.
Molecular Weight 13kDa
Gene ID 8115
NCBI Accession NP_068801, NM_021966
UniProt P56279
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TCL1A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Herling, Patel, Teitell et al.: "High TCL1 expression and intact T-cell receptor signaling define a hyperproliferative subset of T-cell prolymphocytic leukemia." in: Blood, Vol. 111, Issue 1, pp. 328-37, 2007 (PubMed).

Alternatives for antigen "T-Cell Leukemia/lymphoma 1A (TCL1A)", type "Antibodies"
Hosts (22), (9), (7)
Reactivities (27), (14), (5)
Applications (21), (15), (7), (5), (3), (3), (2), (1), (1), (1)
Conjugates (2), (1), (1)
Epitopes (11), (3), (1), (1), (1)
Beacon