T-Cell Leukemia/lymphoma 1A (TCL1A) (N-Term) antibody

Details for Product No. ABIN504546
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms TCL1, Tcl1, Tcl1a, TCL1A
Epitope
N-Term
(11), (3), (2), (1), (1), (1)
Reactivity
Human
(32), (13), (6)
Host
Rabbit
(23), (13), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (1), (1)
Application
Western Blotting (WB)
(23), (19), (7), (6), (5), (4), (3), (3), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504546
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TCL1A
Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIE IKDRLQLRVL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against TCL1A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TCL1A
Background TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3,promote nuclear translocation of AKT1,enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.
Molecular Weight 13 kDa
Gene ID 8115
NCBI Accession NM_021966, NP_068801
UniProt P56279
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 114 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-T-Cell Leukemia/lymphoma 1A (TCL1A) (N-Term) antibody WB Suggested Anti-TCL1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
Background publications Herling, Patel, Teitell et al.: "High TCL1 expression and intact T-cell receptor signaling define a hyperproliferative subset of T-cell prolymphocytic leukemia." in: Blood, Vol. 111, Issue 1, pp. 328-37, 2007 (PubMed).

Hosts (23), (13), (7)
Reactivities (32), (13), (6)
Applications (23), (19), (7), (6), (5), (4), (3), (3), (2), (1), (1)
Conjugates (2), (1), (1)
Epitopes (11), (3), (2), (1), (1), (1)
back to top