Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504576

serine/threonine Kinase 17a (STK17A) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DRAK1, RDRAK1, im:6905684, LOC100226911, STK17A
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504576
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A
Sequence KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFE EPLLQEIPGE
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Guinea pig : 93%, Chicken : 88%
Characteristics This is a rabbit polyclonal antibody against STK17A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name STK17A
Background STK17A belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily. It contains 1 protein kinase domain. STK17A acts as a positive regulator of apoptosis.This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.
Molecular Weight 46kDa
Gene ID 9263
NCBI Accession NP_004751, NM_004760
UniProt Q9UEE5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-STK17A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Sanjo, Kawai, Akira: "DRAKs, novel serine/threonine kinases related to death-associated protein kinase that trigger apoptosis." in: The Journal of biological chemistry, Vol. 273, Issue 44, pp. 29066-71, 1998 (PubMed).

Alternatives for antigen "serine/threonine Kinase 17a (STK17A)", type "Antibodies"
Hosts (50), (12), (3)
Reactivities (65), (19), (13), (1), (1), (1), (1)
Applications (52), (23), (10), (9), (8), (3), (3), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (5), (5), (4), (3), (2), (1), (1)
Beacon