serine/threonine Kinase 17a (STK17A) (C-Term) antibody

Details for Product No. ABIN504576
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms DRAK1, RDRAK1, im:6905684, LOC100226911, STK17A
Epitope
C-Term
(11), (5), (4), (4), (3), (1), (1), (1)
Reactivity
Rabbit, Cow (Bovine), Human, Chicken
(62), (16), (13)
Host
Rabbit
(48), (12), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(50), (24), (10), (9), (8), (4), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN504576
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human STK17A
Sequence KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFE EPLLQEIPGE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Guinea pig : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against STK17A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name STK17A
Background STK17A belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily. It contains 1 protein kinase domain. STK17A acts as a positive regulator of apoptosis.This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.
Molecular Weight 46 kDa
Gene ID 9263
NCBI Accession NM_004760, NP_004751
UniProt Q9UEE5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 414 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-serine/threonine Kinase 17a (STK17A) (C-Term) antibody WB Suggested Anti-STK17A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Sanjo, Kawai, Akira: "DRAKs, novel serine/threonine kinases related to death-associated protein kinase that trigger apoptosis." in: The Journal of biological chemistry, Vol. 273, Issue 44, pp. 29066-71, 1998 (PubMed).

Hosts (48), (12), (2)
Reactivities (62), (16), (13)
Applications (50), (24), (10), (9), (8), (4), (3), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (5), (4), (4), (3), (1), (1), (1)
back to top