• Homepage
  • Proteins
  • Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ) (AA 18-247), (full length...

Adiponectin, C1Q and Collagen Domain Containing (ADIPOQ) (AA 18-247), (full length) protein (His tag)

Details for Product No. ABIN1046473
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Protein Name
Synonyms ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28, APN, Acdc, apM1, 30kDa, adipo, Acrp30, ADN, MGC84292, ADIPOQ
Protein Characteristics
AA 18-247, full length
Origin
Mouse (Murine)
(72), (32), (13), (6), (4), (1), (1), (1)
Source
Escherichia coli (E. coli)
(60), (24), (9), (2), (1), (1), (1)
Protein Type Recombinant
Purification tag / Conjugate
His tag
Application
ELISA, Western Blotting (WB), Particle-Enhanced Turbidimetric Assay (PETIA)
Pubmed 2 references available
Catalog no. ABIN1046473
Quantity 200 µg
Price
687.50 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 9 to 11 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Sequence EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPG RDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGF PGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTK IFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVS LFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQ VYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Characteristics Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Purity 95%
Alternative Name Adiponectin
Background Synonyms: 30 kDa adipocyte complement-related protein,Adipocyte complement-related 30 kDa protein,ACRP30,Adipocyte, C1q and collagen domain-containing protein,Adipocyte-specific protein AdipoQ
Molecular Weight 29 kD
UniProt Q60994
Research Area Cancer, Atherosclerosis, Metabolism, Hormones
Comment

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Restrictions For Research Use only
Format Liquid
Buffer 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0, 200 mM Imidazole
Storage -20 °C
Product cited in: Yamauchi, Kamon, Waki et al.: "The fat-derived hormone adiponectin reverses insulin resistance associated with both lipoatrophy and obesity." in: Nature medicine, Vol. 7, Issue 8, pp. 941-6, 2001 (PubMed).

Wang, Xu, Knight et al.: "Hydroxylation and glycosylation of the four conserved lysine residues in the collagenous domain of adiponectin. Potential role in the modulation of its insulin-sensitizing activity." in: The Journal of biological chemistry, Vol. 277, Issue 22, pp. 19521-9, 2002 (PubMed).

Hosts (60), (24), (9), (2), (1), (1), (1)
Reactivities (72), (32), (13), (6), (4), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top