• Homepage
  • Antibodies
  • anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (Middle Regio...

General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (Middle Region) antibody

Details for Product No. ABIN1107468
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms gtf2f2, wu:fb39a05, zgc:86775, RAP30, btf4, gtf2f2.1, tf2f2, tfiif, BTF4, TF2F2, TFIIF, GTF2F2, Afu8g05490, An16g07220, AO090005000596
Epitope
Middle Region
(3), (3), (3), (2), (2), (1)
Reactivity
Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis
(17), (7), (7), (5), (3), (3), (3), (3)
Host
Rabbit
(15), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(17), (6), (3), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN1107468
Quantity 50 µg
Price
401.50 $   Plus shipping costs $45.00
Shipping to United States (Change)
Availability Will be delivered in 6 to 8 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The immunogen for anti-GTF2F2 antibody: synthetic peptide directed towards the middle region of human GTF2F2
Sequence IEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADKQ
Purification Purified on peptide immunoaffinity column
Alternative Name GTF2F2
Background TFIIF is a general transcription initiation factor that binds to RNA polymerase II and helps to recruit it to the initiation complex in collaboration with TFIIB. It promotes transcription elongation. This subunit shows ATP-dependent DNA-helicase activity. GTF2F2 is a 249 amino acid protein of 29 kDa. Official protein name is Transcription initiation factor IIF subunit beta.
Alternate names: ATP-dependent helicase GTF2F2, General transcription factor IIF subunit 2, RAP30, TFIIF- beta, Transcription initiation factor IIF subunit beta
Gene ID 2963
NCBI Accession NP_004119
Restrictions For Research Use only
Reconstitution Add 50 µL of distilled water
Handling Advice Avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Heng, Xiao, Shi et al.: "Genes encoding general initiation factors for RNA polymerase II transcription are dispersed in the human genome." in: Human molecular genetics, Vol. 3, Issue 1, pp. 61-4, 1994 (PubMed).

Hosts (15), (2)
Reactivities (17), (7), (7), (5), (3), (3), (3), (3)
Applications (17), (6), (3), (2), (2)
Epitopes (3), (3), (3), (2), (2), (1)
back to top