Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182328

L(3)mbt-Like 2 (Drosophila) (L3MBTL2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms L3MBT, H-l(3)mbt-l, 4732493N06Rik, M4mbt, L3MBTL2, im:7137244, wu:fb04e09, zgc:66491
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Rat (Rattus), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182328
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-L3MBTL2 antibody: synthetic peptide directed towards the C terminal of human L3MBTL2
Sequence EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKA KEATKKKKKQ
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Rabbit : 100%, Pig : 92%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against L3MBTL2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name L3MBTL2
Background L3MBTL2 contains 1 FCS-type zinc finger and 4 MBT repeats. It is putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis.
Molecular Weight 79kDa
Gene ID 83746
NCBI Accession NP_113676, NM_031488
UniProt Q969R5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-L3MBTL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "L(3)mbt-Like 2 (Drosophila) (L3MBTL2)", type "Antibodies"
Hosts (12), (3)
Reactivities (15), (4), (4), (3), (2), (1)
Applications (15), (5), (1), (1)
Epitopes (7), (3), (2), (2), (1)
Beacon