Did you know that you can buy products from over 140 different suppliers from us?

L(3)mbt-Like 2 (Drosophila) (L3MBTL2) (C-Term) antibody

Details for Product No. ABIN182328
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms L3MBT, H-l(3)mbt-l, 4732493N06Rik, M4mbt, L3MBTL2, im:7137244, wu:fb04e09, zgc:66491
Epitope
C-Term
(10), (7), (3), (2), (1), (1)
Reactivity
Dog (Canine), Rat (Rattus), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human
(20), (4), (4), (3), (2), (1)
Host
Rabbit
(17), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(19), (9), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182328
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human L3MBTL2
Sequence EYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKA KEATKKKKKQ
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Rabbit : 100 %, Pig : 90 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against L3MBTL2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name L3MBTL2
Background L3MBTL2 contains 1 FCS-type zinc finger and 4 MBT repeats. It is putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis.
Molecular Weight 79 kDa
Gene ID 83746
NCBI Accession NM_031488, NP_113676
UniProt Q969R5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 705 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-L(3)mbt-Like 2 (Drosophila) (L3MBTL2) (C-Term) antibody anti-L(3)mbt-Like 2 (Drosophila) (L3MBTL2) (C-Term) antibody
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (17), (3)
Reactivities (20), (4), (4), (3), (2), (1)
Applications (19), (9), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (10), (7), (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182328
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top