Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6) (N-Term) antibody

Details for Product No. ABIN182517
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms EAR2, EAR-2, ERBAL2, Erbal2, AV090102, COUP-TF3, COUP(II), NR2F6, couptf2, fc94g11, wu:fc94g11, zgc:77259, ear-2, ear2, erbal2
Epitope
N-Term
(12), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(31), (12), (12), (4), (2), (1), (1), (1)
Host
Rabbit
(30), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(24), (12), (9), (9), (8), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN182517
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NR2F6
Sequence MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAAS DAEPGDEERP
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Pig : 90 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against NR2F6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name NR2F6
Background NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily
Molecular Weight 43 kDa
Gene ID 2063
NCBI Accession NM_005234, NP_005225
UniProt P10588
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 404 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
General Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Hosts (30), (3)
Reactivities (31), (12), (12), (4), (2), (1), (1), (1)
Applications (24), (12), (9), (9), (8), (3), (1)
Epitopes (12), (2), (2), (2), (2), (1), (1), (1), (1), (1)
back to top