Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182517

Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EAR2, EAR-2, ERBAL2, Erbal2, AV090102, COUP-TF3, COUP(II), NR2F6, couptf2, fc94g11, wu:fc94g11, zgc:77259, ear-2, ear2, erbal2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182517
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6
Sequence MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAAS DAEPGDEERP
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Pig : 92%, Mouse : 86%, Rat : 86%
Characteristics This is a rabbit polyclonal antibody against NR2F6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name NR2F6
Background NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily
Molecular Weight 43kDa
Gene ID 2063
NCBI Accession NP_005225, NM_005234
UniProt P10588
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NR2F6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6)", type "Antibodies"
Hosts (29), (5), (1)
Reactivities (33), (12), (12), (5), (2), (1), (1), (1), (1)
Applications (25), (13), (9), (7), (6), (1), (1)
Epitopes (12), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon