Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182754

Cyclin L1 (CCNL1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANIA6A, PRO1073, ania-6a, Ccnl, AU018493, 2610030E23Rik, Ania-6a, MCM2, cyclin-L1, ccnl1, fd99b09, wu:fd99b09, zgc:55544, MGC132032, bm-001, pro1073, MGC108436, Ccnl1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN182754
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCNL1 antibody: synthetic peptide directed towards the N terminal of human CCNL1
Sequence TTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQ DGLDLPSETD
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against CCNL1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CCNL1
Background CCNL1 plays a critical role in the loco-regional progression of HNSCC and may serve as an indicator for occult advanced tumour stages. CCNL1 also plays a role in pre-mRNA splicing, has been shown to associate with the PITSLRE kinase, and is involved in pre-mRNA processing.
Molecular Weight 60kDa
Gene ID 57018
NCBI Accession NP_064703, NM_020307
UniProt Q8NI48
Research Area Chromatin and Nuclear Signaling, DNA/RNA, Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCNL1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Clark, Edwards, Peterson et al.: "Fugu ESTs: new resources for transcription analysis and genome annotation." in: Genome research, Vol. 13, Issue 12, pp. 2747-53, 2003 (PubMed).

Alternatives for antigen "Cyclin L1 (CCNL1)", type "Antibodies"
Hosts (35), (3)
Reactivities (37), (25), (23), (14), (11), (11), (3), (1)
Applications (29), (22), (14), (10), (9), (6), (5), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (1), (1), (1), (1), (1), (1)
Beacon