Did you know that you can buy products from over 140 different suppliers from us?

T-Box 6 (TBX6) (Middle Region) antibody

Details for Product No. ABIN182800
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms rv, Xtbx6, TBX6, tbx6
Epitope
Middle Region
(8), (8), (6), (4), (4), (4), (3), (3), (3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(56), (23), (18), (14), (13)
Host
Rabbit
(45), (10), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(35), (28), (10), (7), (7), (7), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182800
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TBX6
Sequence AKGFRENGRNCKRERDARVKRKLRGPEPAATEAYGSGDTP GGPCDSTLGG
Predicted Reactivity Human : 100 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %, Bovine : 80 %
Characteristics This is a rabbit polyclonal antibody against TBX6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TBX6
Background TBX6 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx6. Knockout experiments in mice indicate that Tbx6 is important for specification of paraxial mesoderm structures.
Molecular Weight 47 kDa
Gene ID 6911
NCBI Accession NM_004608, NP_004599
UniProt O95947
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 436 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-T-Box 6 (TBX6) (Middle Region) antibody WB Suggested Anti-TBX6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Papapetrou, Putt, Fox et al.: "The human TBX6 gene: cloning and assignment to chromosome 16p11.2." in: Genomics, Vol. 55, Issue 2, pp. 238-41, 1999 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182800
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top