Did you know that you can buy products from over 140 different suppliers from us?

2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP) (N-Term) antibody

Details for Product No. ABIN182899
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CNP1, Cnp1, Cnp-1, CNPase, CNPF, CNPI, CNPII, CNP, lbab, cnpl, fd21d08, fi37a10, rich, sb:cb662, si:ch73-158e11.4, wu:fd21d08, wu:fd44a05, wu:fi35d08, wu:fi37a10, DKFZp469F1421
Epitope
N-Term
(5), (5), (4), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Cow (Bovine), Human
(79), (41), (36), (14), (12), (7), (3), (1)
Host
Rabbit
(61), (18), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunoprecipitation (IP), Western Blotting (WB)
(71), (26), (23), (20), (15), (10), (8), (5), (4), (3), (2), (2), (2), (1), (1)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182899
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CNP
Sequence YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTN HERERLEQLF
Predicted Reactivity Horse : 100 %, Dog : 90 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against CNP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CNP
Background 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm
Molecular Weight 45 kDa
Gene ID 1267
NCBI Accession NM_033133, NP_149124
UniProt P09543-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 401 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP) (N-Term) antibody WB Suggested Anti-CNP Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Background publications Peirce, Bray, Williams et al.: "Convergent evidence for 2',3'-cyclic nucleotide 3'-phosphodiesterase as a possible susceptibility gene for schizophrenia." in: Archives of general psychiatry, Vol. 63, Issue 1, pp. 18-24, 2006 (PubMed).

General Peirce, Petry, Stitzer et al.: "Effects of lower-cost incentives on stimulant abstinence in methadone maintenance treatment: a National Drug Abuse Treatment Clinical Trials Network study." in: Archives of general psychiatry, Vol. 63, Issue 2, pp. 201-8, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182899
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top