Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182899

2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CNP1, Cnp1, Cnp-1, CNPase, CNPF, CNPI, CNPII, CNP, lbab, cnpl, fd21d08, fi37a10, rich, sb:cb662, si:ch73-158e11.4, wu:fd21d08, wu:fd44a05, wu:fi35d08, wu:fi37a10, DKFZp469F1421
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunoprecipitation (IP)
Pubmed 2 references available
Catalog no. ABIN182899
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CNP antibody: synthetic peptide directed towards the N terminal of human CNP
Sequence YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTN HERERLEQLF
Predicted Reactivity Horse : 100%, Dog : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against CNP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CNP
Background 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm
Molecular Weight 45kDa
Gene ID 1267
NCBI Accession NP_149124, NM_033133
UniProt P09543-2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CNP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Peirce, Bray, Williams et al.: "Convergent evidence for 2',3'-cyclic nucleotide 3'-phosphodiesterase as a possible susceptibility gene for schizophrenia." in: Archives of general psychiatry, Vol. 63, Issue 1, pp. 18-24, 2006 (PubMed).

Peirce, Petry, Stitzer et al.: "Effects of lower-cost incentives on stimulant abstinence in methadone maintenance treatment: a National Drug Abuse Treatment Clinical Trials Network study." in: Archives of general psychiatry, Vol. 63, Issue 2, pp. 201-8, 2006 (PubMed).

Alternatives for antigen "2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP)", type "Antibodies"
Hosts (56), (22), (9)
Reactivities (78), (42), (40), (15), (13), (7), (5), (1), (1), (1)
Applications (71), (28), (24), (21), (18), (10), (9), (5), (4), (3), (2), (2), (2), (1), (1), (1), (1)
Conjugates (4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (5), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon