Thyroid Hormone Receptor Interactor 13 (TRIP13) (N-Term) antibody

Details for Product No. ABIN183210
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 16E1BP, D13Ertd328e, 2410002G23Rik, PCH2, TRIP-13, 16e1bp, trip-13, im:6901078, zgc:65952, pch2, TRIP13
Epitope
N-Term
(5), (5), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Pig (Porcine), Dog (Canine), Human, Chicken
(42), (24), (24), (13), (13), (12), (1)
Host
Rabbit
(37), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(33), (13), (10), (6), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183210
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRIP13
Sequence KDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAA NHWVLPAAEF
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against TRIP13. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TRIP13
Background The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. TRIP13 specifically interacts with the ligand binding domain of the TRs. It is a member of Trips (TR-interacting proteins) family. Nearly all of the Trips also show similar ligand-dependent interaction with the retinoid X receptor (RXR), but none interact with the glucocorticoid receptor under any conditions. Trips predict specific functional roles: one is an apparent human homolog of a yeast transcriptional coactivator, one is a new member of a class of nonhistone chromosomal proteins, and one contains a conserved domain associated with ubiquitination of specific target proteins.
Molecular Weight 49 kDa
Gene ID 9319
NCBI Accession NM_004237, NP_004228
UniProt Q15645
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 432 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Thyroid Hormone Receptor Interactor 13 (TRIP13) (N-Term) antibody WB Suggested Anti-TRIP13 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Hosts (37), (5)
Reactivities (42), (24), (24), (13), (13), (12), (1)
Applications (33), (13), (10), (6), (4), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (5), (2), (2), (1)
back to top