Interferon Regulatory Factor 5 (IRF5) (N-Term) antibody

Details for Product No. ABIN183457
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms SLEB10, mirf5, AW491843, im:7155364, zgc:76986, IRF5, irf5
Epitope
N-Term
(8), (7), (5), (3), (3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus)
(60), (21), (11), (5), (2), (1), (1), (1), (1)
Host
Rabbit
(28), (26), (9), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(58), (34), (15), (11), (11), (8), (8), (3), (3), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183457
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of mouse IRF5
Sequence CSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITE PALPGPPNAP
Predicted Reactivity Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against IRF5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name IRF5
Background The activation of Toll-like receptors (TLRs) is central to innate and adaptive immunity. All TLRs use the adaptor MyD88 for signaling. IRF-5 is generally involved downstream of the TLR-MyD88 signalling pathway for gene induction of proinflammatory cytokines, such as interleukin-6 (IL-6), IL-12 and tumour-necrosis factor-alpha.
Molecular Weight 55 kDa
Gene ID 27056
NCBI Accession NM_012057, NP_036187
UniProt P56477
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Innate Immunity, Cytokines
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 497 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Takaoka, Yanai, Kondo et al.: "Integral role of IRF-5 in the gene induction programme activated by Toll-like receptors." in: Nature, Vol. 434, Issue 7030, pp. 243-9, 2005 (PubMed).

Hosts (28), (26), (9), (1)
Reactivities (60), (21), (11), (5), (2), (1), (1), (1), (1)
Applications (58), (34), (15), (11), (11), (8), (8), (3), (3), (3), (2), (2), (2), (1)
Epitopes (8), (7), (5), (3), (3), (2), (2), (1), (1), (1)
back to top