Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183457

Interferon Regulatory Factor 5 (IRF5) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SLEB10, mirf5, AW491843, im:7155364, zgc:76986, IRF5, irf5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183457
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IRF5 antibody: synthetic peptide directed towards the N terminal of mouse IRF5
Sequence CSNGPAPTESQPTDDYVLGEEEEEEEEELQRMLPGLSITE PALPGPPNAP
Predicted Reactivity Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against IRF5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IRF5
Background The activation of Toll-like receptors (TLRs) is central to innate and adaptive immunity. All TLRs use the adaptor MyD88 for signaling. IRF-5 is generally involved downstream of the TLR-MyD88 signalling pathway for gene induction of proinflammatory cytokines, such as interleukin-6 (IL-6), IL-12 and tumour-necrosis factor-alpha.
Molecular Weight 55kDa
Gene ID 27056
NCBI Accession NP_036187, NM_012057
UniProt P56477
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Innate Immunity, Cytokines
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IRF5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Takaoka, Yanai, Kondo et al.: "Integral role of IRF-5 in the gene induction programme activated by Toll-like receptors." in: Nature, Vol. 434, Issue 7030, pp. 243-9, 2005 (PubMed).

Alternatives for antigen "Interferon Regulatory Factor 5 (IRF5)", type "Antibodies"
Hosts (26), (22), (11), (1)
Reactivities (61), (20), (10), (5), (2), (1), (1), (1), (1)
Applications (56), (35), (15), (12), (9), (8), (4), (3), (3), (2), (2), (2), (1), (1)
Epitopes (9), (7), (5), (3), (3), (2), (2), (2), (1)
Beacon