Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183466

T-Bet (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TBT1, Tbet, Tblym, TBET, T-PET, T-bet, TBLYM
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN183466
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the C terminal of mouse TBX21
Sequence MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKR RRISPYPSSG
Predicted Reactivity Human : 92%, Mouse : 92%, Pig : 92%, Rabbit : 92%, Rat : 92%, Bovine : 85%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against TBX21. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name TBX21
Background TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.
Molecular Weight 58kDa
Gene ID 57765
NCBI Accession NP_062380, NM_019507
UniProt Q9JKD8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TBX21 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hirata, Nakazawa, Yoshihara et al.: "Zinc-finger gene Fez in the olfactory sensory neurons regulates development of the olfactory bulb non-cell-autonomously." in: Development (Cambridge, England), Vol. 133, Issue 8, pp. 1433-43, 2006 (PubMed).

Hirata, Nakazawa, Muraoka et al.: "Zinc-finger genes Fez and Fez-like function in the establishment of diencephalon subdivisions." in: Development (Cambridge, England), Vol. 133, Issue 20, pp. 3993-4004, 2006 (PubMed).

Alternatives for antigen "T-Bet", type "Antibodies"
Hosts (38), (25)
Reactivities (56), (37), (19), (16), (16), (13), (2)
Applications (41), (21), (10), (10), (8), (8), (4), (2), (2), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (5), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon