T-Bet (C-Term) antibody

Details for Product No. ABIN183466
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TBT1, Tbet, Tblym, TBET, T-PET, T-bet, TBLYM
Epitope
C-Term
(6), (5), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(58), (37), (19), (16), (16), (13), (2)
Host
Rabbit
(39), (27)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(43), (20), (12), (12), (10), (8), (3), (2), (2), (2), (2), (1)
Pubmed 2 references available
Catalog no. ABIN183466
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of mouse TBX21
Sequence MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKR RRISPYPSSG
Predicted Reactivity Human : 92 %, Mouse : 92 %, Pig : 92 %, Rabbit : 92 %, Rat : 92 %, Bovine : 82 %, Dog : 82 %
Characteristics This is a rabbit polyclonal antibody against TBX21. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TBX21
Background TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.
Molecular Weight 58 kDa
Gene ID 57765
NCBI Accession NM_019507, NP_062380
UniProt Q9JKD8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 530 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-T-Bet (C-Term) antibody WB Suggested Anti-TBX21 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: SP2/0 cell lysate
Background publications Hirata, Nakazawa, Yoshihara et al.: "Zinc-finger gene Fez in the olfactory sensory neurons regulates development of the olfactory bulb non-cell-autonomously." in: Development (Cambridge, England), Vol. 133, Issue 8, pp. 1433-43, 2006 (PubMed).

General Hirata, Nakazawa, Muraoka et al.: "Zinc-finger genes Fez and Fez-like function in the establishment of diencephalon subdivisions." in: Development (Cambridge, England), Vol. 133, Issue 20, pp. 3993-4004, 2006 (PubMed).

Hosts (39), (27)
Reactivities (58), (37), (19), (16), (16), (13), (2)
Applications (43), (20), (12), (12), (10), (8), (3), (2), (2), (2), (2), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (5), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top