Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183541

Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Acrb2, Acrb-2, [b]2-nAchR, C030030P04Rik, EFNL3, nAChRB2, NACHRB2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183541
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHRNB2 antibody: synthetic peptide directed towards the middle region of human CHRNB2
Sequence KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLD DFTPSGEWDI
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Mouse : 92%, Pig : 92%, African clawed frog : 85%
Characteristics This is a rabbit polyclonal antibody against CHRNB2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name CHRNB2
Background Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information.
Molecular Weight 57kDa
Gene ID 1141
NCBI Accession NP_000739, NM_000748
UniProt P17787
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHRNB2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Feng, Niu, Xing et al.: "A common haplotype of the nicotine acetylcholine receptor alpha 4 subunit gene is associated with vulnerability to nicotine addiction in men." in: American journal of human genetics, Vol. 75, Issue 1, pp. 112-21, 2004 (PubMed).

Alternatives for antigen "Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2)", type "Antibodies"
Hosts (39), (6), (1)
Reactivities (42), (22), (20), (19), (19), (18), (18), (2)
Applications (31), (16), (15), (10), (6), (6), (5), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (4), (3), (1), (1), (1)
Beacon