Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2) (Middle Region) antibody

Details for Product No. ABIN183541
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Acrb2, Acrb-2, [b]2-nAchR, C030030P04Rik, EFNL3, nAChRB2, NACHRB2
Epitope
Middle Region
(6), (4), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Xenopus laevis, Human, Chicken
(41), (22), (20), (19), (19), (18), (18), (2)
Host
Rabbit
(37), (5), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(30), (15), (14), (10), (8), (5), (5), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183541
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CHRNB2
Sequence KIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLD DFTPSGEWDI
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Mouse : 90 %, Pig : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against CHRNB2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name CHRNB2
Background Mutations in nAChRs are found in a rare form of nocturnal frontal lobe epilepsy . Previously, some nAChR mutations have been described that are associated with additional neurological features such as psychiatric disorders or cognitive defects. A new CHRNB2 mutation located in transmembrane region 3 (M3), outside the known ADNFLE mutation cluster. The CHRNB2 mutation I312M, which occurred de novo in twins, markedly increases the receptor's sensitivity to acetylcholine. Phenotypically, the mutation is associated not only with typical ADNFLE, but also with distinct deficits in memory. The cognitive problems are most obvious in tasks requiring the organization and storage of verbal information.
Molecular Weight 57 kDa
Gene ID 1141
NCBI Accession NM_000748, NP_000739
UniProt P17787
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 502 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cholinergic Receptor, Nicotinic, beta 2 (Neuronal) (CHRNB2) (Middle Region) antibody WB Suggested Anti-CHRNB2 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Feng, Niu, Xing et al.: "A common haplotype of the nicotine acetylcholine receptor alpha 4 subunit gene is associated with vulnerability to nicotine addiction in men." in: American journal of human genetics, Vol. 75, Issue 1, pp. 112-21, 2004 (PubMed).

Hosts (37), (5), (3)
Reactivities (41), (22), (20), (19), (19), (18), (18), (2)
Applications (30), (15), (14), (10), (8), (5), (5), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (3), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top