Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183582

LIM Homeobox Transcription Factor 1, alpha (LMX1A) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LMX1, LMX1.1, Lmx1.1, dr, dreher, sst, si:ch211-260g14.3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183582
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LMX1A antibody: synthetic peptide corresponding to a region of Mouse
Sequence AIEQSVYNSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDS DDTSLSNLGD
Predicted Reactivity Mouse : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Horse : 92%, Human : 92%, Chicken : 91%
Characteristics This is a rabbit polyclonal antibody against LMX1A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name LMX1A
Background Lmx1a acts as a transcriptional activator by binding to an A/T-rich sequence, the FLAT element, in the insulin gene promoter. It is required for development of the roof plate and, in turn, for specification of dorsal cell fates in the CNS and developing vertebrae.
Molecular Weight 42kDa
Gene ID 110648
NCBI Accession NP_387501, NM_033652
UniProt Q9JKU8
Research Area Stem Cells, Transcription Factors, Neurogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LMX1A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Katayama, Tomaru, Kasukawa et al.: "Antisense transcription in the mammalian transcriptome." in: Science (New York, N.Y.), Vol. 309, Issue 5740, pp. 1564-6, 2005 (PubMed).

Alternatives for antigen "LIM Homeobox Transcription Factor 1, alpha (LMX1A)", type "Antibodies"
Hosts (34)
Reactivities (31), (27), (20), (14), (13), (13), (13), (1), (1)
Applications (25), (12), (10), (5), (5), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (4), (3), (2), (2), (2)
Beacon