Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 2 (PSMC2) (N-Term) antibody

Details for Product No. ABIN183624
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MSS1, xMSS1, Nbla10058, S7, zgc:63995, NCU02840.1, An02g12760, 23.m06337, AO090020000414, DDBDRAFT_0168337, DDBDRAFT_0232966, DDB_0168337, DDB_0232966, psmc2
Epitope
N-Term
(5), (3), (3), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(39), (18), (18), (13), (1), (1), (1)
Host
Rabbit
(30), (8), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(28), (13), (10), (8), (7), (4), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183624
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PSMC2
Sequence MPDYLGADQRKTKEVEKDDKPIRALDEGDIALLKTYGQST YSRQIKQVED
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Horse : 90 %, Zebrafish : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against PSMC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PSMC2
Background PSMC2 is one of the ATPase subunits. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This su
Molecular Weight 49 kDa
Gene ID 5701
NCBI Accession NM_002803, NP_002794
UniProt Q3LIA5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 433 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 2 (PSMC2) (N-Term) antibody WB Suggested Anti-PSMC2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Background publications Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway...." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).

Hosts (30), (8), (1)
Reactivities (39), (18), (18), (13), (1), (1), (1)
Applications (28), (13), (10), (8), (7), (4), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top