Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183624

Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 2 (PSMC2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MSS1, xMSS1, Nbla10058, S7, zgc:63995, NCU02840.1, An02g12760, 23.m06337, AO090020000414, DDBDRAFT_0168337, DDBDRAFT_0232966, DDB_0168337, DDB_0232966, psmc2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183624
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PSMC2 antibody: synthetic peptide directed towards the N terminal of human PSMC2
Sequence MPDYLGADQRKTKEVEKDDKPIRALDEGDIALLKTYGQST YSRQIKQVED
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Horse : 92%, Zebrafish : 92%, African clawed frog : 85%
Characteristics This is a rabbit polyclonal antibody against PSMC2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PSMC2
Background PSMC2 is one of the ATPase subunits. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This su
Molecular Weight 49kDa
Gene ID 5701
NCBI Accession NP_002794, NM_002803
UniProt Q3LIA5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PSMC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bouwmeester, Bauch, Ruffner et al.: "A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway." in: Nature cell biology, Vol. 6, Issue 2, pp. 97-105, 2004 (PubMed).

Alternatives for antigen "Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 2 (PSMC2)", type "Antibodies"
Hosts (28), (7), (1)
Reactivities (36), (16), (16), (13), (1), (1), (1)
Applications (25), (12), (10), (6), (6), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (3), (3), (1)
Beacon