Did you know that you can buy products from over 140 different suppliers from us?

Thyroid Hormone Receptor Interactor 13 (TRIP13) (C-Term) antibody

Details for Product No. ABIN183656
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms im:6901078, zgc:65952, 16e1bp, pch2, trip-13, TRIP13, 16E1BP, PCH2, TRIP-13, 2410002G23Rik, D13Ertd328e
Epitope
C-Term
(6), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Human, Chicken
(47), (24), (24), (13), (13), (12), (1), (1)
Host
Rabbit
(41), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(38), (11), (10), (6), (4), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183656
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TRIP13
Sequence LSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDKQF EERKKLAAYI
Predicted Reactivity Horse : 100 %, Bovine : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against TRIP13. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TRIP13
Background The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. TRIP13 specifically interacts with the ligand binding domain of the TRs. It is a member of Trips (TR-interacting proteins) family. Nearly all of the Trips also show similar ligand-dependent interaction with the retinoid X receptor (RXR), but none interact with the glucocorticoid receptor under any conditions. Trips predict specific functional roles: one is an apparent human homolog of a yeast transcriptional coactivator, one is a new member of a class of nonhistone chromosomal proteins, and one contains a conserved domain associated with ubiquitination of specific target proteins.
Molecular Weight 49 kDa
Gene ID 9319
NCBI Accession NM_004237, NP_004228
UniProt Q15645
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 432 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Thyroid Hormone Receptor Interactor 13 (TRIP13) (C-Term) antibody WB Suggested Anti-TRIP13 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Thyroid Hormone Receptor Interactor 13 (TRIP13) (C-Term) antibody (2) Rabbit Anti-TRIP13 Antibody ,Paraffin Embedded Tissue: Human Lung cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 µg/mL
Magnification:.00X
anti-Thyroid Hormone Receptor Interactor 13 (TRIP13) (C-Term) antibody (3) WB Suggested Anti-TRIP13
Antibody Titration: 5.0 µg/mL ELISA Titer: 1:.12500
Positive Control: HepG2 cell lysate
TRIP13 is supported by BioGPS gene expression data to be expressed in HepG2
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Validation Images
back to top