Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183656

Thyroid Hormone Receptor Interactor 13 (TRIP13) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 16E1BP, D13Ertd328e, 2410002G23Rik, PCH2, TRIP-13, 16e1bp, trip-13, im:6901078, zgc:65952, pch2, TRIP13
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183656
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIP13 antibody: synthetic peptide directed towards the C terminal of human TRIP13
Sequence LSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDKQF EERKKLAAYI
Predicted Reactivity Horse : 100%, Bovine : 90%, Guinea pig : 81%
Characteristics This is a rabbit polyclonal antibody against TRIP13. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name TRIP13
Background The thyroid hormone (T3) receptors (TRs) are hormone-dependent transcription factors that regulate expression of a variety of specific target genes. TRIP13 specifically interacts with the ligand binding domain of the TRs. It is a member of Trips (TR-interacting proteins) family. Nearly all of the Trips also show similar ligand-dependent interaction with the retinoid X receptor (RXR), but none interact with the glucocorticoid receptor under any conditions. Trips predict specific functional roles: one is an apparent human homolog of a yeast transcriptional coactivator, one is a new member of a class of nonhistone chromosomal proteins, and one contains a conserved domain associated with ubiquitination of specific target proteins.
Molecular Weight 49kDa
Gene ID 9319
NCBI Accession NP_004228, NM_004237
UniProt Q15645
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIP13 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "Thyroid Hormone Receptor Interactor 13 (TRIP13)", type "Antibodies"
Hosts (36), (6)
Reactivities (42), (21), (21), (13), (13), (12), (1), (1)
Applications (33), (14), (10), (6), (6), (5), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (6), (2), (2), (2), (1)
Beacon