MYC Induced Nuclear Antigen (MINA) (N-Term) antibody

Details for Product No. ABIN183830
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms MDIG, MINA53, NO52, ROX, AI449204, 1810047J07Rik, 2410057H13Rik, 3830408E23Rik, Mina53, MINA, mina, MGC83527, DKFZp459K0725
Epitope
N-Term
(17), (5), (4)
Reactivity
Human
(32), (14), (5), (2), (2), (1)
Host
Rabbit
(32)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(32), (15), (14), (5), (3)
Pubmed 1 reference available
Catalog no. ABIN183830
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MINA
Sequence MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSS LFESLISPIK
Predicted Reactivity Human : 100 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against MINA. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name MINA
Background MINA is a protein with a molecular weight of 53 kDa, which is localized in the nucleus and with part of the protein concentrated in the nucleolus. It is a direct target gene of Myc and is involved in mammalian cell proliferation.
Molecular Weight 32 kDa
Gene ID 84864
NCBI Accession NM_153182, NP_694822
UniProt Q8IUF6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 280 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MYC Induced Nuclear Antigen (MINA) (N-Term) antibody anti-MYC Induced Nuclear Antigen (MINA) (N-Term) antibody
Background publications Zhang, Lu, Yuan et al.: "The Human mineral dust-induced gene, mdig, is a cell growth regulating gene associated with lung cancer." in: Oncogene, Vol. 24, Issue 31, pp. 4873-82, 2005 (PubMed).

Hosts (32)
Reactivities (32), (14), (5), (2), (2), (1)
Applications (32), (15), (14), (5), (3)
Epitopes (17), (5), (4)
back to top