Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183831

MYC Induced Nuclear Antigen (MINA) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MDIG, MINA53, NO52, ROX, AI449204, 1810047J07Rik, 2410057H13Rik, 3830408E23Rik, Mina53, MINA, mina, MGC83527, DKFZp459K0725
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183831
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MINA antibody: synthetic peptide directed towards the C terminal of human MINA
Sequence HGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVL SLWTECLIQV
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Bovine : 92%, Mouse : 92%, Rat : 92%, Chicken : 76%
Characteristics This is a rabbit polyclonal antibody against MINA. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name MINA
Background MINA protein is directly involved in ribosome biogenesis, most likely during the assembly process of preribosomal particles. MINA is also involved in cell proliferation. MINA may have a role in esophageal squamous cell carcinoma, colon cancer and lung cancer
Molecular Weight 53kDa
Gene ID 84864
NCBI Accession NP_116167, NM_032778
UniProt Q96KB0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MINA antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhang, Lu, Yuan et al.: "The Human mineral dust-induced gene, mdig, is a cell growth regulating gene associated with lung cancer." in: Oncogene, Vol. 24, Issue 31, pp. 4873-82, 2005 (PubMed).

Alternatives for antigen "MYC Induced Nuclear Antigen (MINA)", type "Antibodies"
Hosts (32), (1)
Reactivities (33), (11), (3), (1), (1)
Applications (33), (16), (13), (5), (3), (1)
Epitopes (18), (6), (4), (2), (1), (1)
Beacon