MYC Induced Nuclear Antigen (MINA) (C-Term) antibody

Details for Product No. ABIN183831
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms MDIG, MINA53, NO52, ROX, AI449204, 1810047J07Rik, 2410057H13Rik, 3830408E23Rik, Mina53, MINA, mina, MGC83527, DKFZp459K0725
Epitope
C-Term
(18), (4), (4), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(34), (13), (4), (1), (1)
Host
Rabbit
(32), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(34), (16), (14), (5), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN183831
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MINA
Sequence HGLRFPLSHLDALKQIWNSPAISVKDLKLTTDEEKESLVL SLWTECLIQV
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Bovine : 90 %, Mouse : 90 %, Rat : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against MINA. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name MINA
Background MINA protein is directly involved in ribosome biogenesis, most likely during the assembly process of preribosomal particles. MINA is also involved in cell proliferation. MINA may have a role in esophageal squamous cell carcinoma, colon cancer and lung cancer
Molecular Weight 53 kDa
Gene ID 84864
NCBI Accession NM_032778, NP_116167
UniProt Q96KB0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 464 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MYC Induced Nuclear Antigen (MINA) (C-Term) antibody WB Suggested Anti-MINA Antibody Titration: 5.0ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
Background publications Zhang, Lu, Yuan et al.: "The Human mineral dust-induced gene, mdig, is a cell growth regulating gene associated with lung cancer." in: Oncogene, Vol. 24, Issue 31, pp. 4873-82, 2005 (PubMed).

Hosts (32), (2)
Reactivities (34), (13), (4), (1), (1)
Applications (34), (16), (14), (5), (3), (2)
Epitopes (18), (4), (4), (2), (2)
back to top