HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1) (C-Term) antibody

Details for Product No. ABIN183873
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Hkr-1, ZNF875, BE688704, 1700025J14Rik, 4930429A13Rik, HKR1, DKFZp459M128
Epitope
C-Term
(7), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(22), (1), (1), (1), (1), (1)
Host
Rabbit
(22), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (8), (8), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN183873
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human HKR1
Sequence RECGQGFSRQSHLIRHQRTHSGEKPYICRKCGRGFSRKSN LIRHQRTHSG
Predicted Reactivity Horse : 100 %, Human : 100 %
Characteristics This is a rabbit polyclonal antibody against HKR1. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name HKR1
Background HKR1 is one of the GLI-Kruppel family of human genes. Members of this family have similar H-C links, i.e., a conserved stretch of 9 amino acids connecting the C-terminal histidine of one finger to the N-terminal cysteine of the next. On the basis of amino acid sequence and intron-exon organization, the genes could be placed into one of two subgroups: the GLI subgroup (with the consensus finger amino acid sequence [Y/F]XCX3GCX3[F/Y]X5LX2HX3-4H[T/S]GEKP) or the Kr subgroup (with the consensus finger amino acid sequence [Y/F]XCX2CX3FX5LX2HXRXHTGEKP).
Molecular Weight 75 kDa
Gene ID 284459
NCBI Accession NM_181786, NP_861451
UniProt Q6PJD0
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 659 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1) (C-Term) antibody WB Suggested Anti-HKR1 Antibody Titration: 0.125ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
anti-HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1) (C-Term) antibody (2) anti-HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1) (C-Term) antibody (Image 2)
anti-HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1) (C-Term) antibody (3) anti-HKR1, GLI-Kruppel Zinc Finger Family Member (HKR1) (C-Term) antibody (Image 3)
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Hosts (22), (1)
Reactivities (22), (1), (1), (1), (1), (1)
Applications (22), (8), (8), (3), (3), (1)
Epitopes (7), (2), (2), (2), (1), (1), (1)
back to top