Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183963

Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DYT16, PACT, RAX, PRKRA
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183963
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the middle region of human PRKRA
Sequence RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQA KRNAAEKFLA
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against PRKRA. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name PRKRA
Background PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).
Molecular Weight 34kDa
Gene ID 8575
NCBI Accession NP_003681, NM_003690
UniProt O75569
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRKRA antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lee, Hur, Park et al.: "The role of PACT in the RNA silencing pathway." in: The EMBO journal, Vol. 25, Issue 3, pp. 522-32, 2006 (PubMed).

Alternatives for antigen "Protein Kinase, Interferon-Inducible Double Stranded RNA Dependent Activator (PRKRA)", type "Antibodies"
Hosts (28), (12)
Reactivities (37), (5), (5), (2), (1), (1)
Applications (32), (14), (7), (7), (6), (6), (3), (2), (2), (1)
Epitopes (5), (4), (3), (3), (2), (2), (1), (1), (1), (1)
Beacon