Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183964

Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
EIF3-ETA, EIF3-P110, EIF3-P116, EIF3S9, PRT1, Eif3s9, AL033316, AL033334, AL033369, AW208965, D5Wsu45e, eIF-3-eta, eif3-eta, eif3-p110, eif3-p116, eif3s9, prt1, ATEIF3B-2, EIF3B, EUKARYOTIC TRANSLATIO ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183964
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EIF3S9 antibody: synthetic peptide directed towards the C terminal of human EIF3S9
Sequence YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETI EFFVTEEIIP
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against EIF3S9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EIF3S9
Background EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.
Molecular Weight 90kDa
Gene ID 8662
NCBI Accession NP_003742, NM_003751
UniProt P55884
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EIF3S9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Fraser, Lee, Mayeur et al.: "The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro." in: The Journal of biological chemistry, Vol. 279, Issue 10, pp. 8946-56, 2004 (PubMed).

Alternatives for antigen "Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B)", type "Antibodies"
Hosts (17)
Reactivities (16), (3), (2), (1)
Applications (15), (9), (2), (2), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1), (1), (1), (1)
Beacon