Did you know that you can buy products from over 140 different suppliers from us?

Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B) (C-Term) antibody

Details for Product No. ABIN183964
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
EIF3-ETA, EIF3-P110, EIF3-P116, EIF3S9, PRT1, Eif3s9, AL033316, AL033334, AL033369, AW208965, D5Wsu45e, eIF-3-eta, eif3-eta, eif3-p110, eif3-p116, eif3s9, prt1, ATEIF3B-2, EIF3B, EUKARYOTIC TRANSLATIO ... show more
EIF3-ETA, EIF3-P110, EIF3-P116, EIF3S9, PRT1, Eif3s9, AL033316, AL033334, AL033369, AW208965, D5Wsu45e, eIF-3-eta, eif3-eta, eif3-p110, eif3-p116, eif3s9, prt1, ATEIF3B-2, EIF3B, EUKARYOTIC TRANSLATION INITIATION FACTOR 3B, F18A17.30, F18A17_30, eukaryotic translation initiation factor 3B-2, DDBDRAFT_0218512, DDBDRAFT_0233929, DDB_0218512, DDB_0233929, eif3b, wu:fc17c01, GB10123, eIF3b, AO090005000892 show less
Epitope
C-Term
(4), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
(15), (2), (1), (1)
Host
Rabbit
(16)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (8), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183964
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human EIF3S9
Sequence YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETI EFFVTEEIIP
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against EIF3S9. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EIF3S9
Background EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.
Molecular Weight 90 kDa
Gene ID 8662
NCBI Accession NM_003751, NP_003742
UniProt P55884
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 814 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B) (C-Term) antibody WB Suggested Anti-EIF3S9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Fraser, Lee, Mayeur et al.: "The j-subunit of human translation initiation factor eIF3 is required for the stable binding of eIF3 and its subcomplexes to 40 S ribosomal subunits in vitro." in: The Journal of biological chemistry, Vol. 279, Issue 10, pp. 8946-56, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183964
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top