EIF3B antibody (C-Term)
-
- Target See all EIF3B Antibodies
- EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF3B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF3 S9 antibody was raised against the C terminal of EIF3 9
- Purification
- Affinity purified
- Immunogen
- EIF3 S9 antibody was raised using the C terminal of EIF3 9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP
- Top Product
- Discover our top product EIF3B Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF3S9 Blocking Peptide, catalog no. 33R-10226, is also available for use as a blocking control in assays to test for specificity of this EIF3S9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))
- Alternative Name
- EIF3S9 (EIF3B Products)
- Background
- EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.
- Molecular Weight
- 90 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-