Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183979

Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (Yeast) (RRP9) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms U3-55K, RNU3IP2, 55kDa, D19435, D9Wsu10e, Rnu3ip2, U3-55k
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183979
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RRP9 antibody: synthetic peptide directed towards the middle region of human RRP9
Sequence IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLI LIWEAQSCQH
Predicted Reactivity Horse : 92%, Rabbit : 92%, Bovine : 78%, Dog : 78%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against RRP9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name RRP9
Background RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.
Molecular Weight 52kDa
Gene ID 9136
NCBI Accession NP_004695, NM_004704
UniProt O43818
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RRP9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Verheggen, Lafontaine, Samarsky et al.: "Mammalian and yeast U3 snoRNPs are matured in specific and related nuclear compartments." in: The EMBO journal, Vol. 21, Issue 11, pp. 2736-45, 2002 (PubMed).

Alternatives for antigen "Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (Yeast) (RRP9)", type "Antibodies"
Hosts (4), (2)
Reactivities (6)
Applications (6), (3), (3), (3), (1), (1)
Epitopes (2), (1)
Beacon