Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (Yeast) (RRP9) (Middle Region) antibody

Details for Product No. ABIN183979
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Rnu3ip2, RNU3IP2, U3-55K, 55kDa, D19435, D9Wsu10e, U3-55k
Epitope
Middle Region
(7), (3), (1), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Human
(14)
Host
Rabbit
(11), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (9), (6), (6), (3), (2), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183979
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RRP9
Sequence IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLI LIWEAQSCQH
Predicted Reactivity Horse : 92 %, Rabbit : 92 %, Bovine : 72 %, Dog : 72 %, Guinea pig : 72 %
Characteristics This is a rabbit polyclonal antibody against RRP9. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name RRP9
Background RRP9 contains 7 WD repeats and belongs to the WD repeat RRP9 family. It is a component of a nucleolar small nuclear ribonucleoprotein particle (snoRNP) thought to participate in the processing and modification of pre-ribosomal RNA.
Molecular Weight 52 kDa
Gene ID 9136
NCBI Accession NM_004704, NP_004695
UniProt O43818
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 475 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal RNA Processing 9, Small Subunit (SSU) Processome Component, Homolog (Yeast) (RRP9) (Middle Region) antibody WB Suggested Anti-RRP9 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
Background publications Verheggen, Lafontaine, Samarsky et al.: "Mammalian and yeast U3 snoRNPs are matured in specific and related nuclear compartments." in: The EMBO journal, Vol. 21, Issue 11, pp. 2736-45, 2002 (PubMed).

Validation Images
back to top