Did you know that you can buy products from over 140 different suppliers from us?

Splicing Factor Proline/glutamine-Ric (SFPQ) (N-Term) antibody

Details for Product No. ABIN183984
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110004P21Rik, 2810416M14Rik, 5730453G22Rik, 9030402K04Rik, AU021830, D4Ertd314e, Gm12940, OTTMUSG00000009329, PSF, REP1, POMP100, hm:zeh0027, wu:fa11h12, wu:fd10f03, zgc:85935
Epitope
N-Term
(9), (8), (7), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(39), (7), (6), (2), (2), (1), (1), (1)
Host
Rabbit
(22), (17), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(38), (21), (11), (10), (8), (5), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183984
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SFPQ
Sequence VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGH PKPPHRGGGE
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against SFPQ. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name SFPQ
Background SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. SFPQ may be involved in homologous DNA pairing. SFPQ is involved in transcriptional regulation. It binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity.
Molecular Weight 78 kDa
Gene ID 6421
NCBI Accession NM_005066, NP_005057
UniProt P23246
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 707 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Splicing Factor Proline/glutamine-Ric (SFPQ) (N-Term) antibody WB Suggested Anti-SFPQ Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
anti-Splicing Factor Proline/glutamine-Ric (SFPQ) (N-Term) antibody (2) anti-Splicing Factor Proline/glutamine-Ric (SFPQ) (N-Term) antibody (Image 2)
anti-Splicing Factor Proline/glutamine-Ric (SFPQ) (N-Term) antibody (3) anti-Splicing Factor Proline/glutamine-Ric (SFPQ) (N-Term) antibody (Image 3)
Background publications Rosonina, Ip, Calarco et al.: "Role for PSF in mediating transcriptional activator-dependent stimulation of pre-mRNA processing in vivo." in: Molecular and cellular biology, Vol. 25, Issue 15, pp. 6734-46, 2005 (PubMed).

Hosts (22), (17), (3)
Reactivities (39), (7), (6), (2), (2), (1), (1), (1)
Applications (38), (21), (11), (10), (8), (5), (2), (1), (1), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2)
Epitopes (9), (8), (7), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183984
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top