Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183984

Splicing Factor Proline/glutamine-Ric (SFPQ) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110004P21Rik, 2810416M14Rik, 5730453G22Rik, 9030402K04Rik, AU021830, D4Ertd314e, Gm12940, OTTMUSG00000009329, PSF, REP1, POMP100, hm:zeh0027, wu:fa11h12, wu:fd10f03, zgc:85935
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN183984
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SFPQ antibody: synthetic peptide directed towards the N terminal of human SFPQ
Sequence VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGH PKPPHRGGGE
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against SFPQ. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name SFPQ
Background SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. SFPQ may be involved in homologous DNA pairing. SFPQ is involved in transcriptional regulation. It binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity.
Molecular Weight 78kDa
Gene ID 6421
NCBI Accession NP_005057, NM_005066
UniProt P23246
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SFPQ antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rosonina, Ip, Calarco et al.: "Role for PSF in mediating transcriptional activator-dependent stimulation of pre-mRNA processing in vivo." in: Molecular and cellular biology, Vol. 25, Issue 15, pp. 6734-46, 2005 (PubMed).

Alternatives for antigen "Splicing Factor Proline/glutamine-Ric (SFPQ)", type "Antibodies"
Hosts (14), (12), (3)
Reactivities (26), (7), (5), (2), (2), (1), (1), (1)
Applications (26), (11), (8), (7), (6), (5), (2), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon