Did you know that you can buy products from over 140 different suppliers from us?

Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody

Details for Product No. ABIN184032
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms pippin, csdc2, zgc:91826, PIPPIN, dJ347H13.2, AI415250, AI481750, Pippin
Epitope
N-Term
(7), (7), (7), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(31), (14), (12), (12), (12), (12)
Host
Rabbit
(23), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(24), (15), (14), (10), (6), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184032
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CSDC2
Sequence MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGV PPRDLPSPLP
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, Rabbit : 90 %, Dog : 80 %, Pig : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against CSDC2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name CSDC2
Background CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.
Molecular Weight 17 kDa
Gene ID 27254
NCBI Accession NM_014460, NP_055275
UniProt Q9Y534
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 153 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody WB Suggested Anti-CSDC2 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
anti-Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody (2) anti-Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody (Image 2)
anti-Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody (3) WB Suggested Anti-CSDC2
Antibody Titration: 0.625 µg/mL ELISA Titer: 1:.12500
Positive Control: Jurkat cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Validation Images
back to top