Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184032

Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Pippin, AI415250, AI481750, PIPPIN, dJ347H13.2, pippin, csdc2, zgc:91826
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184032
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CSDC2 antibody: synthetic peptide directed towards the N terminal of human CSDC2
Sequence MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGV PPRDLPSPLP
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Guinea pig : 92%, Rabbit : 92%, Dog : 85%, Pig : 85%, Bovine : 78%
Characteristics This is a rabbit polyclonal antibody against CSDC2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name CSDC2
Background CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.
Molecular Weight 17kDa
Gene ID 27254
NCBI Accession NP_055275, NM_014460
UniProt Q9Y534
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CSDC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Cold Shock Domain Containing C2, RNA Binding (CSDC2)", type "Antibodies"
Hosts (18), (4)
Reactivities (20), (14), (12), (12), (12), (12)
Applications (13), (10), (6), (6), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1)
Beacon