CSDC2 antibody (Cold Shock Domain Containing C2, RNA Binding) (N-Term)

Details for Product anti-CSDC2 Antibody No. ABIN629884, Supplier: Log in to see
Antigen
  • pippin
  • csdc2
  • zgc:91826
  • PIPPIN
  • dJ347H13.2
  • AI415250
  • AI481750
  • Pippin
  • cold shock domain containing C2, RNA binding
  • cold shock domain containing C2
  • cold shock domain containing C2, RNA binding a
  • cold shock domain containing C2 L homeolog
  • CSDC2
  • csdc2
  • csdc2a
  • csdc2.L
  • Csdc2
Epitope
N-Term
10
10
9
8
7
3
2
2
1
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
56
20
19
3
3
3
3
3
2
1
1
1
1
1
Host
Rabbit
44
12
Clonality
Polyclonal
Conjugate
This CSDC2 antibody is un-conjugated
4
4
4
3
3
3
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
41
27
27
14
13
6
2
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Immunogen CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP
Specificity CSDC2 antibody was raised against the N terminal of CSDC2
Purification Purified
Alternative Name CSDC2 (CSDC2 Antibody Abstract)
Background CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.
Molecular Weight 17 kDa (MW of target protein)
Application Notes WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

CSDC2 Blocking Peptide, catalog no. 33R-6562, is also available for use as a blocking control in assays to test for specificity of this CSDC2 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSDC2 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Immunohistochemistry (IHC) image for anti-Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody (ABIN629884) CSDC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Western Blotting (WB) image for anti-Cold Shock Domain Containing C2, RNA Binding (CSDC2) (N-Term) antibody (ABIN629884) CSDC2 antibody used at 0.625 ug/ml to detect target protein.
Did you look for something else?