Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184036

Exosome Component 3 (EXOSC3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PCH1B, RP11-3J10.8, RRP40, Rrp40p, bA3J10.7, hRrp-40, p10, Rrp40, AI593501, 2310005D06Rik, im:7140537, zgc:112345
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN184036
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3
Sequence PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQR KQIFSRLAES
Predicted Reactivity Dog : 100%, Horse : 100%, Pig : 100%, Guinea pig : 84%, Mouse : 84%
Characteristics This is a rabbit polyclonal antibody against EXOSC3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name EXOSC3
Background EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
Molecular Weight 30kDa
Gene ID 51010
NCBI Accession NP_057126, NM_016042
UniProt Q9NQT5
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EXOSC3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Alternatives for antigen "Exosome Component 3 (EXOSC3)", type "Antibodies"
Hosts (26), (9)
Reactivities (32), (16), (16), (14), (14), (2), (1)
Applications (24), (10), (10), (7), (6), (3), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (1), (1), (1)
Beacon