Serotonin Receptor 1A (HTR1A) (N-Term) antibody

Details for Product No. ABIN184237
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
Gpcr18, 5HT1A, RAT5HT1A, 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD, 5ht1a, adrb2rl1, adrbrl1, htr1a-A, 5-HT-dro2A, 5-HT1ADro, 5-HT[1A]Dro, 5-HT[[1ADro]], 5-HT[[1A]], 5-HT[[1A]]DRO, 5HT-R2 ... show more
Gpcr18, 5HT1A, RAT5HT1A, 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD, 5ht1a, adrb2rl1, adrbrl1, htr1a-A, 5-HT-dro2A, 5-HT1ADro, 5-HT[1A]Dro, 5-HT[[1ADro]], 5-HT[[1A]], 5-HT[[1A]]DRO, 5HT-R2A, 5HT-dro2A, 5HT-drp[[2A]], 5HT[[1ADro]], 5htdro2a, CG16720, DRO2A, Dm5HTdro2A, Dmel\\CG16720, d5-HT1A, 5htr1a, htr1a, HTR1A, Htr1a, 5-Ht1a show less
Epitope
N-Term
(8), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Human
(33), (25), (21)
Host
Rabbit
(41), (5), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1)
Application
Western Blotting (WB)
(43), (22), (10), (5), (4), (4), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN184237
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HTR1A
Sequence GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTL IFCAVLGNAC
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against HTR1A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HTR1A
Background This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
Molecular Weight 46 kDa
Gene ID 3350
NCBI Accession NM_000524, NP_000515
UniProt P08908
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 422 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Serotonin Receptor 1A (HTR1A) (N-Term) antibody anti-Serotonin Receptor 1A (HTR1A) (N-Term) antibody
Background publications Czesak, Lemonde, Peterson et al.: "Cell-specific repressor or enhancer activities of Deaf-1 at a serotonin 1A receptor gene polymorphism." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 26, Issue 6, pp. 1864-71, 2006 (PubMed).

Hosts (41), (5), (3)
Reactivities (33), (25), (21)
Applications (43), (22), (10), (5), (4), (4), (2), (2), (1), (1)
Conjugates (1), (1)
Epitopes (8), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top