Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184237

Serotonin Receptor 1A (HTR1A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
Gpcr18, 5HT1A, RAT5HT1A, 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD, 5ht1a, adrb2rl1, adrbrl1, htr1a-A, 5-HT-dro2A, 5-HT1ADro, 5-HT[1A]Dro, 5-HT[[1ADro]], 5-HT[[1A]], 5-HT[[1A]]DRO, 5HT-R2 ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184237
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HTR1A antibody: synthetic peptide directed towards the N terminal of human HTR1A
Sequence GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTL IFCAVLGNAC
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against HTR1A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HTR1A
Background This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
Molecular Weight 46kDa
Gene ID 3350
NCBI Accession NP_000515, NM_000524
UniProt P08908
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HTR1A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Czesak, Lemonde, Peterson et al.: "Cell-specific repressor or enhancer activities of Deaf-1 at a serotonin 1A receptor gene polymorphism." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 26, Issue 6, pp. 1864-71, 2006 (PubMed).

Alternatives for antigen "Serotonin Receptor 1A (HTR1A)", type "Antibodies"
Hosts (37), (4), (2)
Reactivities (26), (24), (17), (1)
Applications (36), (19), (10), (6), (4), (3), (2), (1), (1)
Conjugates (1), (1)
Epitopes (7), (3), (3), (2), (2), (1), (1), (1)
Beacon