Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184259

Keratin 14 (KRT14) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms K14, NFJ, CK14, EBS3, EBS4, Krt1-14, AI626930, Krt-1.14, Ka14, Krt14, KRT14, ouro2
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN184259
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KRT14 antibody: synthetic peptide directed towards the C terminal of human KRT14
Sequence DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVS THEQVLRTKN
Predicted Reactivity Rat : 100%, Rabbit : 92%, Guinea pig : 85%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against KRT14. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name KRT14
Background KRT14 is a type I keratin, which is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells.
Molecular Weight 52kDa
Gene ID 3861
NCBI Accession NP_000517, NM_000526
UniProt P02533
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KRT14 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Pfendner, Sadowski, Uitto: "Epidermolysis bullosa simplex: recurrent and de novo mutations in the KRT5 and KRT14 genes, phenotype/genotype correlations, and implications for genetic counseling and prenatal diagnosis." in: The Journal of investigative dermatology, Vol. 125, Issue 2, pp. 239-43, 2005 (PubMed).

Alternatives for antigen "Keratin 14 (KRT14)", type "Antibodies"
Hosts (70), (61), (4)
Reactivities (132), (25), (22), (7), (4), (2), (2)
Applications (80), (78), (34), (28), (25), (25), (14), (14), (14), (4), (2), (1), (1)
Conjugates (4), (3)
Epitopes (46), (6), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon