Keratin 14 (KRT14) (C-Term) antibody

Details for Product No. ABIN184259
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms K14, NFJ, CK14, EBS3, EBS4, Krt1-14, AI626930, Krt-1.14, Ka14, Krt14, KRT14, ouro2
Epitope
C-Term
(39), (4), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(127), (23), (19), (7), (4), (2), (2)
Host
Rabbit
(67), (58), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3)
Application
Western Blotting (WB)
(79), (74), (40), (29), (25), (18), (18), (15), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN184259
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KRT14
Sequence DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVS THEQVLRTKN
Predicted Reactivity Rat : 100 %, Rabbit : 90 %, Guinea pig : 80 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against KRT14. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name KRT14
Background KRT14 is a type I keratin, which is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells.
Molecular Weight 52 kDa
Gene ID 3861
NCBI Accession NM_000526, NP_000517
UniProt P02533
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 472 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Pfendner, Sadowski, Uitto: "Epidermolysis bullosa simplex: recurrent and de novo mutations in the KRT5 and KRT14 genes, phenotype/genotype correlations, and implications for genetic counseling and prenatal diagnosis." in: The Journal of investigative dermatology, Vol. 125, Issue 2, pp. 239-43, 2005 (PubMed).

Hosts (67), (58), (4)
Reactivities (127), (23), (19), (7), (4), (2), (2)
Applications (79), (74), (40), (29), (25), (18), (18), (15), (2), (2), (2)
Conjugates (3), (3)
Epitopes (39), (4), (2), (1), (1), (1), (1), (1), (1)
back to top