Myeloid/lymphoid Or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila), Translocated To, 3 (MLLT3) (N-Term) antibody

Details for Product No. ABIN309893
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AF9, YEATS3, 2210011H10Rik, 2610012I03Rik, 3830408D16Rik, Af9, D4Ertd321e, Af-9, fc39c11, wu:fc39c11, zgc:110210
Epitope
N-Term
(7), (5), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
(28), (4), (3), (1), (1), (1)
Host
Rabbit
(27), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(24), (10), (7), (5), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN309893
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MLLT3
Sequence MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPE HSNIQHFVEK
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against MLLT3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MLLT3
Background MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice. Translocation t (9,11)(p22,q23), a chromosomal aberration involving MLLT3 is associated with acute leukemias.
Molecular Weight 63 kDa
Gene ID 4300
NCBI Accession NM_004529, NP_004520
UniProt P42568
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 568 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Myeloid/lymphoid Or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila), Translocated To, 3 (MLLT3) (N-Term) antibody WB Suggested Anti-MLLT3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Wei, Wunderlich, Fox et al.: "Microenvironment determines lineage fate in a human model of MLL-AF9 leukemia." in: Cancer cell, Vol. 13, Issue 6, pp. 483-95, 2008 (PubMed).

Hosts (27), (1)
Reactivities (28), (4), (3), (1), (1), (1)
Applications (24), (10), (7), (5), (2), (1)
Epitopes (7), (5), (3), (2), (2), (1), (1), (1), (1)
back to top