Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309893

Myeloid/lymphoid Or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila), Translocated To, 3 (MLLT3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AF9, YEATS3, 2210011H10Rik, 2610012I03Rik, 3830408D16Rik, Af9, D4Ertd321e, Af-9, fc39c11, wu:fc39c11, zgc:110210
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309893
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MLLT3 antibody: synthetic peptide directed towards the N terminal of human MLLT3
Sequence MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPE HSNIQHFVEK
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against MLLT3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MLLT3
Background MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice. Translocation t (9,11)(p22,q23), a chromosomal aberration involving MLLT3 is associated with acute leukemias.
Molecular Weight 63kDa
Gene ID 4300
NCBI Accession NP_004520, NM_004529
UniProt P42568
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MLLT3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Wei, Wunderlich, Fox et al.: "Microenvironment determines lineage fate in a human model of MLL-AF9 leukemia." in: Cancer cell, Vol. 13, Issue 6, pp. 483-95, 2008 (PubMed).

Alternatives for antigen "Myeloid/lymphoid Or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila), Translocated To, 3 (MLLT3)", type "Antibodies"
Hosts (33), (2)
Reactivities (35), (5), (3), (1), (1), (1)
Applications (29), (17), (8), (6), (2), (1)
Epitopes (7), (5), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon