Did you know that you can buy products from over 140 different suppliers from us?

Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA) (N-Term) antibody

Details for Product No. ABIN310035
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Mud1, U1-A, U1A, Rnu1a1, Rnu1a-1, C430021M15Rik, fc19d01, wu:fc19d01, zgc:77810, mud1, snf, 1500015N06Rik, im:7142962, zgc:101832, Lea1, T30B22.12, U1SNRNP-SPECIFIC PROTEIN, spliceosomal protein U1A
Epitope
N-Term
(8), (5), (5), (4), (3), (2), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(51), (8), (6), (3), (3), (3), (2), (2), (1), (1), (1), (1)
Host
Rabbit
(40), (14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2)
Application
Western Blotting (WB)
(47), (28), (22), (10), (8), (7), (4), (4), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310035
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SNRPA1
Sequence VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATL DQFDAIDFSD
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against SNRPA1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SNRPA1
Background SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.
Molecular Weight 28 kDa
Gene ID 6627
NCBI Accession NM_003090, NP_003081
UniProt P09661
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 255 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (40), (14)
Reactivities (51), (8), (6), (3), (3), (3), (2), (2), (1), (1), (1), (1)
Applications (47), (28), (22), (10), (8), (7), (4), (4), (2)
Conjugates (3), (3), (3), (2), (2), (2)
Epitopes (8), (5), (5), (4), (3), (2), (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310035
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top