Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310035

Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Mud1, U1-A, U1A, Rnu1a1, Rnu1a-1, C430021M15Rik, fc19d01, wu:fc19d01, zgc:77810, mud1, snf, 1500015N06Rik, im:7142962, zgc:101832, Lea1, T30B22.12, U1SNRNP-SPECIFIC PROTEIN, spliceosomal protein U1A
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310035
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SNRPA1 antibody: synthetic peptide directed towards the N terminal of human SNRPA1
Sequence VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATL DQFDAIDFSD
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against SNRPA1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SNRPA1
Background SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.
Molecular Weight 28kDa
Gene ID 6627
NCBI Accession NP_003081, NM_003090
UniProt P09661
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SNRPA1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA)", type "Antibodies"
Hosts (28), (9)
Reactivities (34), (7), (5), (3), (3), (3), (2), (2), (1), (1), (1), (1)
Applications (32), (15), (10), (9), (8), (4), (3), (2), (2)
Conjugates (1), (1), (1)
Epitopes (5), (3), (2), (2), (2), (2), (2), (2), (2), (1)
Beacon