Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310048

Splicing Factor, Suppressor of White-Apricot Homolog (Drosophila) (SFSWAP) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1190005N23Rik, 6330437E22Rik, AI197402, AW212079, SWAP, Sfrs8, Srsf8, SFRS8
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310048
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SFRS8 antibody: synthetic peptide directed towards the N terminal of human SFRS8
Sequence MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGY ACKLFRDDER
Predicted Reactivity Human : 100%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against SFRS8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SFRS8
Background SFRS8 is a human homolog of Drosophila splicing regulatory protein.This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified. Two alternatively spliced variants have been characterized to date.
Molecular Weight 105kDa
Gene ID 6433
NCBI Accession NP_004583, NM_004592
UniProt Q12872
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SFRS8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Alternatives for antigen "Splicing Factor, Suppressor of White-Apricot Homolog (Drosophila) (SFSWAP)", type "Antibodies"
Hosts (20)
Reactivities (18), (1), (1), (1), (1)
Applications (20), (10), (2), (1)
Epitopes (7), (7), (4), (1)
Beacon