Did you know that you can buy products from over 140 different suppliers from us?

Splicing Factor, Suppressor of White-Apricot Homolog (Drosophila) (SFSWAP) (N-Term) antibody

Details for Product No. ABIN310048
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SFRS8, SWAP, 1190005N23Rik, 6330437E22Rik, AI197402, AW212079, Sfrs8, Srsf8
Epitope
N-Term
(12), (10), (8), (3), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(28), (1), (1), (1), (1)
Host
Rabbit
(30)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(29), (18), (2), (2), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310048
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SFRS8
Sequence MYGASGGRAKPERKSGAKEEAGPGGAGGGGSRVELLVFGY ACKLFRDDER
Predicted Reactivity Human : 100 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against SFRS8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name SFRS8
Background SFRS8 is a human homolog of Drosophila splicing regulatory protein.This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified. Two alternatively spliced variants have been characterized to date.
Molecular Weight 105 kDa
Gene ID 6433
NCBI Accession NM_004592, NP_004583
UniProt Q12872
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 951 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Validation Images
back to top