SFRS8 antibody

Catalog No. ABIN633458

Product Details anti-SFRS8 Antibody

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRS8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SFRS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS8 Blocking Peptide, catalog no. 33R-5508, is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRS8

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Alternative Name: SFRS8 (SFSWAP Products)

Synonyms: SFRS8 antibody, SWAP antibody, 1190005N23Rik antibody, 6330437E22Rik antibody, AI197402 antibody, AW212079 antibody, Sfrs8 antibody, Srsf8 antibody, splicing factor SWAP antibody, splicing factor, suppressor of white-apricot homolog (Drosophila) antibody, splicing factor SWAP homolog antibody, SFSWAP antibody, Sfswap antibody

Background: This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified although their full-length natures have not been characterized to date.

Molecular Weight: 105 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization