Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310198

Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FAA, fb59b12, wu:fb59b12, zgc:55316, CG14993, Dmel\\CG14993, dfaa, l(3)64Al, l(3)SH11, PSPTO3550
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310198
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH
Sequence AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGT ISGPEPENFG
Predicted Reactivity Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Rat : 100%, African clawed frog : 92%, Bovine : 92%, Rabbit : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against FAH. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name FAH
Background FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT).
Molecular Weight 46kDa
Gene ID 2184
NCBI Accession NP_000128, NM_000137
UniProt P16930
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAH antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bliksrud, Brodtkorb, Andresen et al.: "Tyrosinaemia type I--de novo mutation in liver tissue suppressing an inborn splicing defect." in: Journal of molecular medicine (Berlin, Germany), Vol. 83, Issue 5, pp. 406-10, 2005 (PubMed).

Alternatives for antigen "Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH)", type "Antibodies"
Hosts (22), (8)
Reactivities (27), (5), (5), (1), (1), (1)
Applications (28), (19), (10), (7), (4), (3), (2), (1)
Conjugates (2)
Epitopes (6), (2), (2), (2), (2), (1), (1)
Beacon