Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH) (C-Term) antibody

Details for Product No. ABIN310198
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FAA, fb59b12, wu:fb59b12, zgc:55316, CG14993, Dmel\\CG14993, dfaa, l(3)64Al, l(3)SH11, PSPTO3550
Epitope
C-Term
(5), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human
(31), (6), (6), (1), (1), (1)
Host
Rabbit
(24), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(32), (21), (10), (8), (4), (4), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN310198
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FAH
Sequence AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGT ISGPEPENFG
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Rat : 100 %, African clawed frog : 90 %, Bovine : 90 %, Rabbit : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against FAH. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name FAH
Background FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT).
Molecular Weight 46 kDa
Gene ID 2184
NCBI Accession NM_000137, NP_000128
UniProt P16930
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 419 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH) (C-Term) antibody anti-Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH) (C-Term) antibody
anti-Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH) (C-Term) antibody (2) anti-Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH) (C-Term) antibody (Image 2)
anti-Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH) (C-Term) antibody (3) Sample Type: Human Liver and Mouse FAH KO liverPrimary Dilution: 1:400
Background publications Bliksrud, Brodtkorb, Andresen et al.: "Tyrosinaemia type I--de novo mutation in liver tissue suppressing an inborn splicing defect." in: Journal of molecular medicine (Berlin, Germany), Vol. 83, Issue 5, pp. 406-10, 2005 (PubMed).

Hosts (24), (10)
Reactivities (31), (6), (6), (1), (1), (1)
Applications (32), (21), (10), (8), (4), (4), (3), (1)
Conjugates (2)
Epitopes (5), (2), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top