Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310477

STEAP Family Member 3, Metalloreductase (STEAP3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AHMIO2, STMP3, TSAP6, dudlin-2, STEAP3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310477
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-STEAP3 antibody: synthetic peptide directed towards the N terminal of human STEAP3
Sequence LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEV IFVAVFREHY
Predicted Reactivity Human : 100%, Mouse : 100%, Horse : 92%, Rabbit : 92%, Bovine : 85%, Guinea pig : 85%, Dog : 78%
Characteristics This is a rabbit polyclonal antibody against STEAP3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name STEAP3
Background AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT
Molecular Weight 54kDa
Gene ID 55240
NCBI Accession NP_001008410, NM_001008410
UniProt Q658P3
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-STEAP3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Amzallag, Passer, Allanic et al.: "TSAP6 facilitates the secretion of translationally controlled tumor protein/histamine-releasing factor via a nonclassical pathway." in: The Journal of biological chemistry, Vol. 279, Issue 44, pp. 46104-12, 2004 (PubMed).

Alternatives for antigen "STEAP Family Member 3, Metalloreductase (STEAP3)", type "Antibodies"
Hosts (29)
Reactivities (27), (16), (16)
Applications (28), (13), (11), (7), (3), (1)
Epitopes (8), (7), (2), (2)
Beacon