Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310536

Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNT1, ZRC1, Znt1, AI839647, C130040I11Rik, ZnT-1, zinc transporter 1 precursor, ZnT1, slc30, MGC53047, XZnSLC30, slc30a1, zgc:77589, zrc1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Pig (Porcine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310536
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC30A1 antibody: synthetic peptide directed towards the middle region of human SLC30A1
Sequence FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTL CVVMVCILLY
Predicted Reactivity Dog : 85%, Horse : 85%, Pig : 85%, Rabbit : 85%
Characteristics This is a rabbit polyclonal antibody against SLC30A1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC30A1
Background SLC30A1 may be involved in zinc transport out of the cell.
Molecular Weight 55kDa
Gene ID 7779
NCBI Accession NP_067017, NM_021194
UniProt Q9Y6M5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC30A1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Overbeck, Uciechowski, Ackland et al.: "Intracellular zinc homeostasis in leukocyte subsets is regulated by different expression of zinc exporters ZnT-1 to ZnT-9." in: Journal of leukocyte biology, Vol. 83, Issue 2, pp. 368-80, 2008 (PubMed).

Alternatives for antigen "Solute Carrier Family 30 (Zinc Transporter), Member 1 (SLC30A1)", type "Antibodies"
Hosts (24)
Reactivities (23), (12), (12), (12), (12), (12)
Applications (15), (10), (9), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1)
Beacon