Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310609

CDGSH Iron Sulfur Domain 2 (CISD2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Zcd2, Miner1, Noxp70, AI848398, 1500009M05Rik, 1500026J14Rik, 1500031D15Rik, B630006A20Rik, RGD1566242, zgc:64148, cisd2, eris, miner1, wfs2, zcd2, ERIS, NAF-1, WFS2, ZCD2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310609
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CISD2 antibody: synthetic peptide directed towards the N terminal of human CISD2
Sequence VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRL LPFLGVLALL
Predicted Reactivity Bovine : 100%, Chicken : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 81%
Characteristics This is a rabbit polyclonal antibody against CISD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CISD2
Background CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).
Molecular Weight 15kDa
Gene ID 493856
NCBI Accession NP_001008389, NM_001008388
UniProt Q8N5K1
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CISD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Amr, Heisey, Zhang et al.: "A homozygous mutation in a novel zinc-finger protein, ERIS, is responsible for Wolfram syndrome 2." in: American journal of human genetics, Vol. 81, Issue 4, pp. 673-83, 2007 (PubMed).

Alternatives for antigen "CDGSH Iron Sulfur Domain 2 (CISD2)", type "Antibodies"
Hosts (5)
Reactivities (4), (3), (3)
Applications (5), (4), (3), (1)
Epitopes (1), (1)
Beacon