CDGSH Iron Sulfur Domain 2 (CISD2) (N-Term) antibody

Details for Product No. ABIN310609
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Zcd2, Miner1, Noxp70, AI848398, 1500009M05Rik, 1500026J14Rik, 1500031D15Rik, B630006A20Rik, RGD1566242, zgc:64148, cisd2, eris, miner1, wfs2, zcd2, ERIS, NAF-1, WFS2, ZCD2
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human
(4), (3), (3)
Host
Rabbit
(5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN310609
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CISD2
Sequence VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRL LPFLGVLALL
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against CISD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CISD2
Background CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).
Molecular Weight 15 kDa
Gene ID 493856
NCBI Accession NM_001008388, NP_001008389
UniProt Q8N5K1
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 135 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Amr, Heisey, Zhang et al.: "A homozygous mutation in a novel zinc-finger protein, ERIS, is responsible for Wolfram syndrome 2." in: American journal of human genetics, Vol. 81, Issue 4, pp. 673-83, 2007 (PubMed).

Hosts (5)
Reactivities (4), (3), (3)
Applications (5), (3), (2)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top