Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CISD2 antibody (CDGSH Iron Sulfur Domain 2) (N-Term) Primary Antibody

CISD2 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN635156
$672.32
Plus shipping costs $45.00
50 μg
local_shipping Shipping to: United States
Delivery in 9 to 11 Business Days
  • Target
    CISD2
    Binding Specificity
    N-Term
    • 4
    • 2
    • 2
    • 2
    • 2
    • 1
    Reactivity
    Human
    • 15
    • 10
    • 6
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Host
    Rabbit
    • 16
    • 1
    Clonality
    Polyclonal
    • 16
    • 1
    Conjugate
    This CISD2 antibody is un-conjugated
    • 14
    • 1
    • 1
    • 1
    Application
    Western Blotting (WB)
    • 14
    • 13
    • 5
    • 4
    • 3
    • 1
    • 1
    • 1
    Specificity
    CISD2 antibody was raised against the N terminal of CISD2
    Purification
    Affinity purified
    Immunogen
    CISD2 antibody was raised using the N terminal of CISD2 corresponding to a region with amino acids VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    CISD2 Blocking Peptide, catalog no. 33R-9652, is also available for use as a blocking control in assays to test for specificity of this CISD2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CISD2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    CISD2
    Alternative Name
    CISD2 (CISD2 Antibody Abstract)
    Synonyms
    ERIS, Miner1, NAF-1, WFS2, ZCD2, 1500009M05Rik, 1500026J14Rik, 1500031D15Rik, AI848398, B630006A20Rik, Noxp70, Zcd2, RGD1566242, zgc:64148, eris, miner1, wfs2, zcd2, cisd2, CDGSH iron sulfur domain 2, CDGSH iron sulfur domain 2 L homeolog, CDGSH iron sulfur domain 2 S homeolog, CISD2, Cisd2, cisd2, cisd2.L, cisd2.S
    Background
    CISD2 is a zinc finger protein that localizes to the endoplasmic reticulum. It binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2 (WFS2).
    Molecular Weight
    15 kDa (MW of target protein)
    Pathways
    Activation of Innate immune Response
You are here:
help Support