Did you know that you can buy products from over 140 different suppliers from us?

Peptidyl-tRNA Hydrolase 2 (PTRH2) (C-Term) antibody

Details for Product No. ABIN310619
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BIT1, PTH2, A230072I16Rik, Bit1, CGI-147, wu:fj09f02, zgc:109954, RGD1306819
Epitope
C-Term
(17), (9), (8), (7), (6), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(59), (31), (22), (11), (11), (11)
Host
Rabbit
(58), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(50), (29), (18), (10), (9), (7), (3), (2)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310619
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PTRH2
Sequence RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLT VSLIQDAGRT
Predicted Reactivity Dog : 100 %, Human : 100 %, Chicken : 90 %, Mouse : 90 %, Rat : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against PTRH2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PTRH2
Background The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.
Molecular Weight 20 kDa
Gene ID 51651
NCBI Accession NM_001015509, NP_001015509
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Cell Cycle, Apoptosis/Necrosis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 180 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Peptidyl-tRNA Hydrolase 2 (PTRH2) (C-Term) antibody WB Suggested Anti-PTRH2 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate
Background publications Jan, Matter, Pai et al.: "A mitochondrial protein, Bit1, mediates apoptosis regulated by integrins and Groucho/TLE corepressors." in: Cell, Vol. 116, Issue 5, pp. 751-62, 2004 (PubMed).

Validation Images
back to top