Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310619

Peptidyl-tRNA Hydrolase 2 (PTRH2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BIT1, PTH2, Bit1, CGI-147, A230072I16Rik, RGD1306819, wu:fj09f02, zgc:109954
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310619
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PTRH2 antibody: synthetic peptide directed towards the C terminal of human PTRH2
Sequence RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLT VSLIQDAGRT
Predicted Reactivity Dog : 100%, Human : 100%, Chicken : 92%, Mouse : 92%, Rat : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against PTRH2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PTRH2
Background The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.
Molecular Weight 20kDa
Gene ID 51651
NCBI Accession NP_001015509, NM_001015509
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Cell Cycle, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PTRH2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jan, Matter, Pai et al.: "A mitochondrial protein, Bit1, mediates apoptosis regulated by integrins and Groucho/TLE corepressors." in: Cell, Vol. 116, Issue 5, pp. 751-62, 2004 (PubMed).

Alternatives for antigen "Peptidyl-tRNA Hydrolase 2 (PTRH2)", type "Antibodies"
Hosts (50), (2)
Reactivities (50), (30), (22), (11), (11), (11)
Applications (41), (18), (14), (9), (9), (8), (4), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (7), (4), (2), (2), (2), (1), (1)
Beacon