Did you know that you can buy products from over 140 different suppliers from us?

Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3) (N-Term) antibody

Details for Product No. ABIN310758
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fi03g03, zgc:63805, Su(var)3-9, wu:fi03g03, wu:fi37d04, EIF2, EIF2G, eIF-2gA, EIF2gamma, Eif2g, Eif2s3, PP42, ENSMUSG00000079297, EIF2S3, eif2, eif2g, eif2s3y, eif2gamma
Epitope
N-Term
(7), (6), (3), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Zebrafish (Danio rerio), Chicken
(22), (4), (4), (1), (1), (1), (1)
Host
Rabbit
(19), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(24), (14), (5), (3), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310758
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human EIF2S3
Sequence LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHV SFVDCPGHDI
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Zebrafish : 100 %, African clawed frog : 90 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against EIF2S3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name EIF2S3
Background EIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
Molecular Weight 51 kDa
Gene ID 1968
NCBI Accession NM_001415, NP_001406
UniProt P41091
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 472 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3) (N-Term) antibody WB Suggested Anti-EIF2S3 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate
Background publications Gevaert, Goethals, Martens et al.: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." in: Nature biotechnology, Vol. 21, Issue 5, pp. 566-9, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310758
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top