Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310758

Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fi03g03, zgc:63805, Su(var)3-9, wu:fi03g03, wu:fi37d04, EIF2, EIF2G, eIF-2gA, EIF2gamma, Eif2g, Eif2s3, PP42, ENSMUSG00000079297, EIF2S3, eif2, eif2g, eif2s3y, eif2gamma
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Zebrafish (Danio rerio), Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310758
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EIF2S3 antibody: synthetic peptide directed towards the N terminal of human EIF2S3
Sequence LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHV SFVDCPGHDI
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Zebrafish : 100%, African clawed frog : 92%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against EIF2S3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name EIF2S3
Background EIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
Molecular Weight 51kDa
Gene ID 1968
NCBI Accession NP_001406, NM_001415
UniProt P41091
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EIF2S3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gevaert, Goethals, Martens et al.: "Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides." in: Nature biotechnology, Vol. 21, Issue 5, pp. 566-9, 2003 (PubMed).

Alternatives for antigen "Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3)", type "Antibodies"
Hosts (13), (5)
Reactivities (16), (3), (3), (1), (1), (1), (1)
Applications (18), (9), (3), (3), (1)
Epitopes (3), (3), (2), (2), (2), (1)
Beacon