EIF2S3 antibody (N-Term)
-
- Target See all EIF2S3 Antibodies
- EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF2S3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF2 S3 antibody was raised against the N terminal of EIF2 3
- Purification
- Purified
- Immunogen
- EIF2 S3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids LDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDI
- Top Product
- Discover our top product EIF2S3 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF2S3 Blocking Peptide, catalog no. 33R-4841, is also available for use as a blocking control in assays to test for specificity of this EIF2S3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF2S3 (Eukaryotic Translation Initiation Factor 2, Subunit 3 Gamma, 52kDa (EIF2S3))
- Alternative Name
- EIF2S3 (EIF2S3 Products)
- Synonyms
- EIF2 antibody, EIF2G antibody, EIF2gamma antibody, eIF-2gA antibody, Su(var)3-9 antibody, fi03g03 antibody, wu:fi03g03 antibody, wu:fi37d04 antibody, zgc:63805 antibody, EIF2S3 antibody, eif2 antibody, eif2g antibody, eif2s3y antibody, eif2gamma antibody, Eif2g antibody, Eif2s3 antibody, PP42 antibody, ENSMUSG00000079297 antibody, eukaryotic translation initiation factor 2 subunit gamma antibody, eukaryotic translation initiation factor 2, subunit 3 gamma antibody, eukaryotic translation initiation factor 2 subunit gamma S homeolog antibody, putative eukaryotic translation initiation factor 2 subunit 3-like protein antibody, eukaryotic translation initiation factor 2 subunit 3 antibody, predicted pseudogene 2223 antibody, EIF2S3 antibody, eif2s3 antibody, eif2s3.S antibody, LOC738402 antibody, LOC100179499 antibody, LOC100624149 antibody, Eif2s3 antibody, Gm2223 antibody
- Background
- EIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA. This complex binds to a 40S ribosomal subunit, followed by mRNA binding to form a 43S preinitiation complex. Junction of the 60S ribosomal subunit to form the 80S initiation complex is preceded by hydrolysis of the GTP bound to eIF-2 and release of an eIF-2-GDP binary complex. In order for eIF-2 to recycle and catalyze another round of initiation, the GDP bound to eIF-2 must exchange with GTP by way of a reaction catalyzed by eIF-2B.
- Molecular Weight
- 51 kDa (MW of target protein)
-