Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibody

Details for Product No. ABIN310767
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms PBD10A, TRG18, 1700014F15Rik, 2810027F19Rik, 2900010N04Rik, zgc:56313, Peroxin-3, DDBDRAFT_0204086, DDBDRAFT_0238047, DDB_0204086, DDB_0238047
Epitope
N-Term
(3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(12), (8), (8)
Host
Rabbit
(11), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(13), (8), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN310767
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PEX3
Sequence KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVL SMLPTLREAL
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against PEX3. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name PEX3
Background PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.
Molecular Weight 42 kDa
Gene ID 8504
NCBI Accession NM_003630, NP_003621
UniProt P56589
Research Area Signaling, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 373 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibody anti-Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibody
anti-Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibody (2) anti-Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibody (Image 2)
Background publications Fang, Morrell, Jones et al.: "PEX3 functions as a PEX19 docking factor in the import of class I peroxisomal membrane proteins." in: The Journal of cell biology, Vol. 164, Issue 6, pp. 863-75, 2004 (PubMed).

Hosts (11), (2)
Reactivities (12), (8), (8)
Applications (13), (8), (3), (1)
Epitopes (3), (1), (1), (1)
back to top