Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310767

Peroxisomal Biogenesis Factor 3 (PEX3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PBD10A, TRG18, 1700014F15Rik, 2810027F19Rik, 2900010N04Rik, zgc:56313, Peroxin-3, DDBDRAFT_0204086, DDBDRAFT_0238047, DDB_0204086, DDB_0238047
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310767
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PEX3 antibody: synthetic peptide directed towards the N terminal of human PEX3
Sequence KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVL SMLPTLREAL
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against PEX3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name PEX3
Background PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.
Molecular Weight 42kDa
Gene ID 8504
NCBI Accession NP_003621, NM_003630
UniProt P56589
Research Area Signaling, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PEX3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Fang, Morrell, Jones et al.: "PEX3 functions as a PEX19 docking factor in the import of class I peroxisomal membrane proteins." in: The Journal of cell biology, Vol. 164, Issue 6, pp. 863-75, 2004 (PubMed).

Alternatives for antigen "Peroxisomal Biogenesis Factor 3 (PEX3)", type "Antibodies"
Hosts (8), (1)
Reactivities (8), (5), (5)
Applications (9), (6), (2), (1)
Epitopes (2), (1)
Beacon