Did you know that you can buy products from over 140 different suppliers from us?

Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) antibody

Details for Product No. ABIN310811
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CDT1, fc37h07, im:7158083, wu:fc37h07, wu:fi38h09, xcdt1, DUP, RIS2, 2610318F11Rik, AW545653, C76791, Ris2, dup, ris2
Epitope
C-Term
(7), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(18), (3), (3)
Host
Rabbit
(12), (6)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(16), (5), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310811
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human CDT1
Sequence PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMT RCPEQEQRLQ
Predicted Reactivity Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Bovine : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against CDT1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CDT1
Background CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication. It binds DNA in a sequence-, strand-, and conformation-independent manner and is a potential oncogene.
Molecular Weight 60 kDa
Gene ID 81620
NCBI Accession NM_030928, NP_112190
UniProt Q9H211
Research Area Chromatin and Nuclear Signaling, Transcription Factors, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 546 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) antibody WB Suggested Anti-CDT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) antibody (2) Sample Type: 3. rat brain extract (80ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science
Background publications Hu, Xiong: "An evolutionarily conserved function of proliferating cell nuclear antigen for Cdt1 degradation by the Cul4-Ddb1 ubiquitin ligase in response to DNA damage." in: The Journal of biological chemistry, Vol. 281, Issue 7, pp. 3753-6, 2006 (PubMed).

Validation Images
back to top