Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310811

Chromatin Licensing and DNA Replication Factor 1 (CDT1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DUP, RIS2, Ris2, C76791, AW545653, 2610318F11Rik, dup, ris2, xcdt1, CDT1, fc37h07, im:7158083, wu:fc37h07, wu:fi38h09
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310811
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CDT1 antibody: synthetic peptide directed towards the C terminal of human CDT1
Sequence PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMT RCPEQEQRLQ
Predicted Reactivity Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Bovine : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against CDT1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CDT1
Background CDT1 cooperates with CDC6 to promote the loading of the mini-chromosome maintenance complex onto chromatin to form the pre-replication complex necessary to initiate DNA replication. It binds DNA in a sequence-, strand-, and conformation-independent manner and is a potential oncogene.
Molecular Weight 60kDa
Gene ID 81620
NCBI Accession NP_112190, NM_030928
UniProt Q9H211
Research Area Chromatin and Nuclear Signaling, Transcription Factors, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CDT1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hu, Xiong: "An evolutionarily conserved function of proliferating cell nuclear antigen for Cdt1 degradation by the Cul4-Ddb1 ubiquitin ligase in response to DNA damage." in: The Journal of biological chemistry, Vol. 281, Issue 7, pp. 3753-6, 2006 (PubMed).

Alternatives for antigen "Chromatin Licensing and DNA Replication Factor 1 (CDT1)", type "Antibodies"
Hosts (10), (7)
Reactivities (16), (2), (2)
Applications (16), (7), (3), (2), (1)
Epitopes (5), (1)
Beacon