Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310835

Zinc Metalloproteinase, Ste24 (Zmpste24) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FACE-1, FACE1, HGPS, PRO1, STE24, Ste24p, MADB, Face-1, D030046F19, A530043O15Rik, fi45a02, zgc:55655, wu:fi45a02, F2N1.21, F2N1_21, DDBDRAFT_0189115, DDBDRAFT_0237846, DDB_0189115, DDB_0237846
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310835
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZMPSTE24 antibody: synthetic peptide directed towards the N terminal of human ZMPSTE24
Sequence LYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQ SLVFLLLATL
Predicted Reactivity Bovine : 100%, Horse : 100%, Rabbit : 100%, Dog : 92%, Chicken : 90%, Zebrafish : 90%, Mouse : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against ZMPSTE24. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZMPSTE24
Background ZMPSTE24 is a member of the peptidase M48A family. This protein is a zinc metalloproteinase involved in the two step post-translational proteolytic cleavage of carboxy terminal residues of farnesylated prelamin A to form mature lamin A. Mutations in ZMPSTE24 gene have been associated with mandibuloacral dysplasia and restrictive dermopathy.The protein encoded by this gene is a zinc metalloprotease similar to yeast Ste24p. It is an integral membrane protein belonging to peptidase family M48 and is found in the endoplasmic reticulum and possibly in the Golgi compartment. It is thought to be involved in the proteolytic processing of farnesylated proteins.
Molecular Weight 55kDa
Gene ID 10269
NCBI Accession NP_005848, NM_005857
UniProt O75844
Research Area Proteolysis / Ubiquitin, Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZMPSTE24 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Moulson, Go, Gardner et al.: "Homozygous and compound heterozygous mutations in ZMPSTE24 cause the laminopathy restrictive dermopathy." in: The Journal of investigative dermatology, Vol. 125, Issue 5, pp. 913-9, 2005 (PubMed).

Alternatives for antigen "Zinc Metalloproteinase, Ste24 (Zmpste24)", type "Antibodies"
Hosts (43), (6)
Reactivities (45), (17), (11), (3), (2)
Applications (45), (11), (6), (4)
Conjugates (4), (4), (2), (1), (1)
Epitopes (16), (7), (3), (2), (2), (2), (2), (1), (1), (1)
Beacon